SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004412 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004412
Domain Number 1 Region: 197-473
Classification Level Classification E-value
Superfamily Mitochondrial carrier 1.14e-73
Family Mitochondrial carrier 0.00012
Further Details:      
 
Domain Number 2 Region: 19-190
Classification Level Classification E-value
Superfamily EF-hand 4.15e-34
Family Calmodulin-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004412   Gene: ENSPFOG00000004443   Transcript: ENSPFOT00000004420
Sequence length 485
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519866.1:479510:489702:1 gene:ENSPFOG00000004443 transcript:ENSPFOT00000004420 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQRSTWILKVQCQEGEHFVPDEERRKHWAELFEQLDLNKDGRIDMLELEAGLAHRGLS
NGCLKKIVETGDTNQDGVLDFEEFVEYLHNHEKQLKVMFHHVDRNKDGRIDVEDIQDCLH
TIGVNVSPEDATRIMLSMDRDGTMTINWSEWRDYFLFKHLSDMEDVARFWKRSMILDTGE
QLTVPEEFSEAQKKSGYMWRQLMAGVMAGSVSRTGTAPLDRLKVFRQVHGSSDFRGSALS
GFKYMLNEGGPWSLWRGNGVNVLKIAPETAIKFSAYEQIKTVMRGHDETRTLRLHERFVA
GSLAGAIAQTIIYPMEVLKTRLNLRKTGQFTGIADCAKQILQREGAAAFYKGYVPNMLSI
VPYAGIDLAVYETLKLSWLNRNTGLSDPGVMVLLGCGAVSSTCGMLASYPLALVRTRMQA
QASVKGSPKLSMLSLLRNIVTQEGIAGLYRGISPNLLKIVPAVSVSYVVYEYMRIMLGVD
IEGGE
Download sequence
Identical sequences A0A087XF59
ENSPFOP00000004412 XP_007570273.1.10163 XP_014909220.1.100837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]