SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004432 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004432
Domain Number 1 Region: 355-538
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-60
Family SPRY domain 0.0000121
Further Details:      
 
Domain Number 2 Region: 6-74
Classification Level Classification E-value
Superfamily RING/U-box 1.77e-17
Family RING finger domain, C3HC4 0.0043
Further Details:      
 
Domain Number 3 Region: 137-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000519
Family B-box zinc-binding domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004432   Gene: ENSPFOG00000004076   Transcript: ENSPFOT00000004440
Sequence length 544
Comment pep:novel scaffold:PoeFor_5.1.2:KI519740.1:523078:530398:1 gene:ENSPFOG00000004076 transcript:ENSPFOT00000004440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKMLPEKQLQCSICLQVFTDPVTTPCGHNFCLVCIGLVWDSSDVCQCPTCNKTFASRPDI
SINTAFKELADTLRQIIVCSSASPLSAAQPGEVVCDVCAATSLQVRAHKSCLVCLTSYCE
AHLEPHRTVATLKLHKLMEPVKNLQDRMCKKHERLLEMFCRMEQMCVCQFCTETEHKDHP
AVTMEDESKERKVHMKQTQADFQQMIQERQKKIEEIKNCLKLSALSAEKEKKASDSLFTS
LINSTKERQAEANAEIEERQRAEEKRAEELIGDLQQEIAELQRRNTELNELENTDDHLHL
LQRLPSLVSPPPTNREWTETRIYPELCVGTVRRALSRLDKTLRKDLDIMKKEAEIRRMQK
YAVDVVLDPDTAHPNIVLSPDGKQAGRGELLHIVPDIPQRFDPVICVLSKKGFRSGRFYF
QVAVGNKTFWDLGVVKESINRKGMITSTPDNGYWTVRLRNASEYRALDSPSILLQLQKRP
KTIGVFADYEEGVVSFFDVDDRSHIYTFTGCLFSERIFPFFSPGVFDHGKNTEPLIITAV
SHET
Download sequence
Identical sequences ENSPFOP00000004432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]