SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000004775 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000004775
Domain Number 1 Region: 348-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.38e-62
Family SPRY domain 0.00000862
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000984
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Domain Number 3 Region: 132-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000382
Family B-box zinc-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000004775   Gene: ENSPFOG00000004743   Transcript: ENSPFOT00000004784
Sequence length 547
Comment pep:novel scaffold:PoeFor_5.1.2:KI519773.1:677331:680303:-1 gene:ENSPFOG00000004743 transcript:ENSPFOT00000004784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASHGLFLSKEQFQCCICQDVFSEPVSIPCGHSFCFTCIKAHWEGRLSIDCPRCHTEYKV
CPELCENSFAKEMSEKIRAGRQDGVPGMTVSCGACVGKQTKALKSCLVCLTSYCESHLEP
HLRVGALKAHKLIEPVEMLENRVCRRHQELLELFCRSHQKFVCVQCVKTDHRCNDTVPLE
RESQDKKGQIKMIQGEVQQRIQDRLQKLEEIRHNLELSKENTKRDIEESGQVFSALSRSI
ERSRAELIELIQRKQKAAEMRAKRLIAGVETEISELLRRRRELEQLLHHEDHLHVLQSFP
AVSSLPSTEDSSDIVVHSETCLGTIRRAVADFREQLQLQLDKLSSREYEKIQQYPADVLL
DPRTANPWLVLSEDGRQVQDGDVMRNVADLPERFDKAPCVLALMGFTTGRRYWEVHVGDK
TAWDLGVARASVKRKGAVTLSPDDGFWTVCLRKGAELWACAGEAELLCVSKRPKVIGVFL
DYEDGVVSFYNAETGSHIYSFTGFRFTEAIFPFFNPDTNENGTNKLPLTIQPIRKRIFGT
DLDDITI
Download sequence
Identical sequences ENSPFOP00000004775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]