SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005372 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005372
Domain Number 1 Region: 382-545
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-48
Family SPRY domain 0.00031
Further Details:      
 
Domain Number 2 Region: 141-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.59e-16
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Domain Number 3 Region: 8-49
Classification Level Classification E-value
Superfamily RING/U-box 0.000000924
Family U-box 0.071
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000005372
Domain Number - Region: 181-298
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00188
Family FCH domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005372   Gene: ENSPFOG00000005475   Transcript: ENSPFOT00000005381
Sequence length 551
Comment pep:novel scaffold:PoeFor_5.1.2:KI520314.1:128831:141471:-1 gene:ENSPFOG00000005475 transcript:ENSPFOT00000005381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQTGAQLEKYSCSICLDLLKDPVTIPCRGLMSQNTIKNRWDFSDSATCGGKPGSQRSSS
PPPTHHIMTLLWFTSVMMGGTRDTPFVHSSAGPEDVACDVCEERKRKAVKSCFTCLASYC
EDHLQPHHDAPPLKKHKLGNPSKTLQDNICSRHDEVMKIFCRTDQQCICYLCTMEEHKGH
ETVPAAAERAEKQKELQKYRQQIHQRIQDQEKDVKLLQQEVEAINVSADKAVEDSEKIFT
ELIRLLQKRSSEVKQQIRSQQETEVSRVKDVRKKLEQEITELKRKDAELEQLSHTEDHTQ
FLLNYPSLPALRESTHSSSINIRPLRHFEDVTAAVSELRDKLQDVLRDSWRNIKMEITEV
DAVKSEPEPNSRAEFIIYSGKFTLDPNTAHTMLFLSEGNRKATVMKQKQFYPDHPDRFTD
YRQVLSRESLTERCYWEVEMRGEGVYIAVSYKNISRAGRSMDAILGFNDKSWSLYFDKGC
YKFWHDRVETPVSGPVSSRIGVYLDHRAGILSFYSVSETMTLLHRVQTTFTQPLHAGIGL
SEGSSAEFVNP
Download sequence
Identical sequences ENSPFOP00000005372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]