SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005392 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005392
Domain Number 1 Region: 376-541
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.91e-44
Family SPRY domain 0.00076
Further Details:      
 
Domain Number 2 Region: 12-82
Classification Level Classification E-value
Superfamily RING/U-box 1.59e-18
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Domain Number 3 Region: 143-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-16
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000005392
Domain Number - Region: 114-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0022
Family FCH domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005392   Gene: ENSPFOG00000005523   Transcript: ENSPFOT00000005401
Sequence length 557
Comment pep:novel scaffold:PoeFor_5.1.2:KI520471.1:29678:31549:1 gene:ENSPFOG00000005523 transcript:ENSPFOT00000005401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGNKIDSGKYSCSTCGDLLKDPVTIPCGHSYCMNCIKDHWDGEDQMEVHSCPQCRKE
FNPRPNLEKNFMLAELVEDLKKSGLQAAAADHCYAGPEDVACDVCTGRKMKAAKSCLVCL
ITYCENHLQPHYQLSAFKKHKLVNPSKTLQDSICSHHEEVMKIFCRTDQQCICYLCLMDE
HKGHETVPAAAERAEKQKELQESRQQIHQRIQDQEEDVKLLQQEVEAINVSADKAVEDSE
KIFTELIRLLQERSSEVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTE
DHTQFLLNYPSLPALRESTHSSSINIRPLRHFEDVTAAVTELRDKLQDVLRDLTTNISLT
VNEVNVLLSEPEPKTRDGFLKYSQEITLDPNTEHKKLFLLSEGNRKVTFVNHEQFYPDHP
DRFDGLCYQVLSTESLTECCYWEVEWRGGGAVAVSYKNISRTERLGSDDQSWSLFFDQNS
YTFYHNNIKTPLARPVSSRIGVYLDHTAGILSFYSVSKTLTLIHRVQTRFTQPLYVGIRV
YFSFSCPDGSSAEFIKP
Download sequence
Identical sequences A0A087XHY9
ENSPFOP00000005392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]