SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005572 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005572
Domain Number 1 Region: 170-237
Classification Level Classification E-value
Superfamily Homeodomain-like 3.68e-21
Family Homeodomain 0.0026
Further Details:      
 
Domain Number 2 Region: 58-124
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000542
Family LIM domain 0.02
Further Details:      
 
Domain Number 3 Region: 28-55
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000267
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005572   Gene: ENSPFOG00000005573   Transcript: ENSPFOT00000005581
Sequence length 311
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519702.1:529569:539450:1 gene:ENSPFOG00000005573 transcript:ENSPFOT00000005581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKPEVKKESGESSPLEAACLCSPPAAKNQCASCGLEIQDRYLLKVNNLNWHLGCLECSV
CRASLRQHSSCYVKNKEIFCKLDYFSRFGTKCAQCGRQVFASDWVRRARGSVYHLACFAC
FSCKRQLSTGEEFGLVEGRVLCRSHYDIMLENLRRAAENGTGLTLEGALPSDQDCQPKPA
KRARTSFTAEQLQVMQTQFAQDNNPDAQTLQKLAEMTGLSRRVIQVWFQNCRARHKKQPP
PQSSSFPQSAPLSRMPPSLPKDLHYSSFSSPDRPHLLALHGYLDAHPFSVLASPGHLTHP
SIALPQLPISR
Download sequence
Identical sequences A0A087XIG9
ENSPFOP00000005572 XP_007557876.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]