SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005858 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005858
Domain Number 1 Region: 347-610
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.12e-85
Family Eukaryotic proteases 0.0000000508
Further Details:      
 
Domain Number 2 Region: 107-200
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-29
Family Kringle modules 0.00022
Further Details:      
 
Domain Number 3 Region: 206-293
Classification Level Classification E-value
Superfamily Kringle-like 1.43e-27
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 41-97
Classification Level Classification E-value
Superfamily GLA-domain 3.03e-19
Family GLA-domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005858   Gene: ENSPFOG00000005196   Transcript: ENSPFOT00000005867
Sequence length 617
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520216.1:63932:69390:1 gene:ENSPFOG00000005196 transcript:ENSPFOT00000005867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPTSKQAAVLLLFVLHSCLANNVFLNSHLASQVLTRNRRANQLWEEMKPGNLERECVK
EICDHEEAREVFEQNDKTEKFWATYLDCKGTEMQRTKENINIIRDCVQGECVIGTGQSYE
GDVNITESGKKCQYWTGRFPHPIYREFNASEPNSILKENFCRNPDNRPGGPWCFTTDPTV
QKETCRVPKCGEVYVPTTVAPEPVRTTVCLPSYGIDYTGDLSVTAKGHTCLAWSSPEAVA
LSRDKDFIPEVVLERNKCRNPDNDPEGPWCYVEISGNITIDYCDLDLCEDPLLGGDQITD
DRGTERTVLGPEKKLFFNPDAFGQGESVCGQRPLFEQKGKQDKNENELLESYREQRVVGG
DDAEVASAPWQVMLYKRSPQELLCGASLISDQWILTAAHCILYPPWNKNYTDKDILVRLG
KHDRAKFERGIEKIVAIDEIIVHPKYNWRENLNRDIALLHLKRPITFSDRIHPICLPSKE
VARTLMSEGFKGRVTGWGNLQETWNPAARNLPAVLQQIHLPIVEQDTCRKSTSVRITNNM
FCAGYKPEESKRGDACEGDSGGPFVMKYPAENRWYQIGIVSWGEGCDRDGKYGFYTHLFR
MGRWMKKVIEKTGGDDD
Download sequence
Identical sequences A0A087XJA5
XP_007541445.1.10163 XP_016521145.1.10163 ENSPFOP00000005858

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]