SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000005898 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000005898
Domain Number 1 Region: 414-609
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.2e-68
Family Nuclear receptor ligand-binding domain 0.0000174
Further Details:      
 
Domain Number 2 Region: 118-208
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.63e-28
Family Nuclear receptor 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000005898   Gene: ENSPFOG00000005825   Transcript: ENSPFOT00000005907
Sequence length 611
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519706.1:1362542:1370294:1 gene:ENSPFOG00000005825 transcript:ENSPFOT00000005907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSASPGGVIAYISSSSSASSPDSCHSDSSNGSYQSSSPRRGSSPSRGRPGQLMDPPLAVG
RQNLPGSQGGGRSSSSGKCGITSKQHTPPCAVRSCCRDPCAVHGSVLLRLILKINGLVLL
CKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKKCLKSESCPIMRMNRNRCQQCRFK
KCLMVGMSRDSVRFGRIPKREKQRMLLEMQSAMNSMMSGGHLQSELSQPHAAGEAAPLTA
AAEKAGPAPSPSGSSQSDSSSDPDGAIPMDTGSSSPSPSVSDSGEDEVIGSVTRAHQETF
MYNQEQGSRAPEGPPRPLNRDLNQAAPVQLSEQGRDVWNHRNNSVNMAGHSLLSILGQPH
SQLDNQCPIRASRSAGTSHSPAYIHGAVRALPTEPCPGGVYSGGAWRGGSRMYLVCPMNT
SPQVDPHKSGQDVWEEFSHSFTPAVREVVEFAKKIPGFRELSQHDQVSLLKAGTFEVLVV
RFASLFHVKERSVTFLGGQKYSVDALRTMGSGDLLSSMFDFCEKLMNLGLSEEEMSLFMA
VVLVSADRSGIENVNSVEALQETLIRALRSLITRNHPNESAIFTKLLLKLPDLRSLNNMH
SEQLLAFKVHS
Download sequence
Identical sequences ENSPFOP00000005898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]