SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006093 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006093
Domain Number 1 Region: 113-127,163-422
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 7.08e-65
Family Nuclear receptor ligand-binding domain 0.0000315
Further Details:      
 
Domain Number 2 Region: 43-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-29
Family Nuclear receptor 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006093   Gene: ENSPFOG00000006106   Transcript: ENSPFOT00000006103
Sequence length 422
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519709.1:1158371:1165457:-1 gene:ENSPFOG00000006106 transcript:ENSPFOT00000006103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDHLTKIPMMPSASPAESSASGGTEDSRGAKSPAPGKALSPALVCKVCGDTSSGKHYGI
YACNGCSGFFKRSVRRRLIYRCQAGTGMCPVDKAHRNQCQACRLKKCLQAGMNKDAVQNE
RQPRSTAQVRLDSIDVDPEKEHLATTREPSASSGSVITWPHITSSMSISSSVAPPRCVSP
QNNHRFMASLMTAETCAKLEPEDVDENIDVTSNEPERASSEYHMALYPSSSENVYETSAR
LLFMSVKWAKNLPVFSNLPFRDQVILLEEAWSELFLLCAIQWSLPLESCPLLSLPDLCPG
MQGKTSYTTLDLRLLQEAFSRFKALAVDPTEFACLKAIVLFKPETRGLKDPEQVENLQDQ
SQVMLGQHIRSHYPTQPARFGKLLLILPSLRFVNSERIELLFFHRTIGNTPMEKLLCDMF
KN
Download sequence
Identical sequences A0A087XJZ0
ENSPFOP00000006093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]