SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006140 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006140
Domain Number 1 Region: 364-533
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.41e-51
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 6.63e-20
Family RING finger domain, C3HC4 0.018
Further Details:      
 
Domain Number 3 Region: 142-198
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000143
Family B-box zinc-binding domain 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000006140
Domain Number - Region: 193-267
Classification Level Classification E-value
Superfamily BAG domain 0.000785
Family BAG domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006140   Gene: ENSPFOG00000006238   Transcript: ENSPFOT00000006150
Sequence length 541
Comment pep:novel scaffold:PoeFor_5.1.2:KI519709.1:1190640:1192361:-1 gene:ENSPFOG00000006238 transcript:ENSPFOT00000006150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEMEQNQLDRETFSCLICLDLLKDPVTTSCGHSYCMNCIKNHWDEEDQKRIHSCPQCRET
FIPRPVLKKNTMLAALVEQLKKTGLQAAPADHCYAGHEDVACDFCTGRKLKAIKSCLVCL
ASYCEKHLQPHYDSAAFKKHKLVEPSKNLQEKICSKHDKLLEIFCRTDQKCICYLCTMDE
HKGHITVSAANFHQKIQDREEDVKLLQQEVEAINLSADKTVEDSEKIFTQLIHFLQKRSS
DVKQQIRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTEDHSQFLLNSPRLPTL
RETTHSSSINIRPLRHFEDVTAAVSELRDKLQDVLRDSWTNISLRLTDVDVLLPEPEPKS
RAGFLKYSCEITLDPNTANTRLVLSEGNRKVKLMNRRQSYPRHPDRFTGCWQVLSRESLT
GRCYWEVERSGTQVYVAVTYKNISRAGGGNKCLFGCNDKSWALDCSQNSFRFCHNNIWTP
IAAPVSSRVGVYLDHRAGILSFYSVSETRTLLHRVQTRFTEPLLAGVSVFCIGGSAEFCK
P
Download sequence
Identical sequences ENSPFOP00000006140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]