SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006156 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006156
Domain Number 1 Region: 277-343
Classification Level Classification E-value
Superfamily Homeodomain-like 1.5e-20
Family Homeodomain 0.0026
Further Details:      
 
Domain Number 2 Region: 110-177
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000187
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 77-109
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000171
Family LIM domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000006156
Domain Number - Region: 172-204
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0036
Family LIM domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006156   Gene: ENSPFOG00000006215   Transcript: ENSPFOT00000006166
Sequence length 427
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519701.1:1211190:1221419:-1 gene:ENSPFOG00000006215 transcript:ENSPFOT00000006166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRSGAGSAPLMDILACRSEENSYNILPSAATMLFHGLPGGDVHGVVEEMERRGKGESAAI
SSAIDMGESETAMPCVTSERVALCAGCGRKIADRYYLLAVDKQWHMRCLKCCECKLNLES
ELTCFSKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDLVYHLNCFTCTTCSKM
LTTGDHFGMKDSLVYCRLHFETLIQGEYQTHFNHADVVAHKGLGPANALGLSYFNGVGTV
QKGRPRKRKSPGPGAELAAYNAALSCNENDGESIDRDSQYSSSQKTKRMRTSFKHHQLRT
MKSYFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNLLRQESTGVDKASDGS
TLQGGTPSGPASEISNASMSPSSTPTTLTDLTNPTMPTVTSVLTSVPGGMDVHECRSPSQ
TTLTSLF
Download sequence
Identical sequences ENSPFOP00000006156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]