SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006251 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006251
Domain Number 1 Region: 877-1153
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 4.26e-71
Family Complement components 0.0000225
Further Details:      
 
Domain Number 2 Region: 1237-1361
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.57e-25
Family Alpha-macroglobulin receptor domain 0.0013
Further Details:      
 
Domain Number 3 Region: 717-770
Classification Level Classification E-value
Superfamily E set domains 0.0000798
Family SVA-like 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006251   Gene: ENSPFOG00000005419   Transcript: ENSPFOT00000006261
Sequence length 1407
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520090.1:262319:282432:1 gene:ENSPFOG00000005419 transcript:ENSPFOT00000006261 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSYLLLAPAGLRPGLPSSVSVTILGSSSVSVSAEIVYENETLSSNSTTIKGGFPAGSTRL
LTLPAIHQVGSSPGRTYTLKVRGRRGSVQLFSNSTELHVDPRGVSTFIQTNQPRYLPGQM
VKIRTVSVRSDGKPCSEPADVLIRDPRGNLLRQWLDKDGVLGVVSTEFQLSENPPLGEWS
IMATIKGVSSVKRFSVDYYVLPKFEVLVKVPDVVHWEDVLKGFVSAKYFYGKPVRGRMVV
TFSHRYHGDNETHSEEAEMDGSGKFRFDVSRFSPSWSRMLIQDQRADVLSVQVSVTEHLT
GLTCNSTVSVALAKSRFSVTFEDFPKVLRPSLSFSGTLKVSTYNGEPLQHQRKLRVSVKQ
QRSRETVDQQILFPKNSSDSSWMDRDESSSEDMELPVPVDGLVPLHIQVQKDTQRLTVEV
SLEDCEKTLSVDRSFRSQSRAYLQVQKPSSPAQVGSRLWLRVEKNFQIPDVHYLVKSRGQ
VVSAGRSSGDVSLVPEVSWAPLASVIVYCVHPGGEVINDVIHLPITHFLQNKVSLSWSSD
LLKPAEVVTLKVSVEEPDSLVGILVVDKATRWAGSNNDITMETVREQMTEWSVDDALSDG
KTMGDPFSVFQTCDLTVMTDASVPREDPTWPLLSKKLEVLQEVRGSTMDGEHFRKQPEPN
QRQNFPETWVWMDVNTGDSDRMQIPLPVPDSITTWTASAFVVSENLGLGLTEKPAELTVF
QDFFLSLNLPAYIIRGEELVLEVVLFNYLQEELEVTVIVAESDAFEFVFPDSEAVAMASV
RRLLVEPEGGATVLVPIRPLVLGDVPIAVKAVSSAAADFVRTTVLVKAEGRPQSFSSSLL
LDLPAGRSGSVAFRFPAGVVDGSQRVSVTAIGDLLGPSISGLDSLVQMPFGCGKQNMIHF
APNVYVLRYLSARGPLDPALQNRATDYMLKGYERQLSYQRADGSFSAFGQQDSSGSTWLT
AFVLRCLLQARPWVGVDGRVLEPGTVIHSELQGGLDGPVSLTAYVLVALLEDGYIRAQYA
SQVTFALGYLEARLDQSVSSNYSLSLLSYALALAGSPASHAALNRLIGRADLRADGVPTW
SSPDAGLSSSWQPRSADIEIASYVLLSLYELNRVDEGLSLMQWLSQQRNHLGGYGSTQDT
VVALQALSAFAALQGSEHSDLDVTVTNVDSGVVASFHIDQNNFLLLQSRQIDPEPVLDLQ
VTASGRGLALLQLNVFYNIRSEELLRRRGAEEHEAFYLKVALFEEQNEAHLFVCTSLARH
LGLNETGMVLMEVGLLSGFSAQPDLVPLGGAVKRVETEPGRAVLYLDSVSTQESCLLVPL
LVEFKVARVQEASVSVYDYYEPRRRTVRSYRSSLRSDVSSCSFCGEDCSRCRANNDYELN
AASRCSRHFLLRHFLPALLLLFVIFSA
Download sequence
Identical sequences ENSPFOP00000006251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]