SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006514 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006514
Domain Number 1 Region: 202-270
Classification Level Classification E-value
Superfamily Homeodomain-like 1.45e-19
Family Homeodomain 0.0032
Further Details:      
 
Domain Number 2 Region: 81-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000214
Family LIM domain 0.0081
Further Details:      
 
Domain Number 3 Region: 52-79
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000559
Family LIM domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000006514
Domain Number - Region: 142-171
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0369
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006514   Gene: ENSPFOG00000006493   Transcript: ENSPFOT00000006525
Sequence length 399
Comment pep:novel scaffold:PoeFor_5.1.2:KI519908.1:609423:625096:1 gene:ENSPFOG00000006493 transcript:ENSPFOT00000006525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPTEISGGVCFTSSDHTEGRREGMKTEENQQSCLQQPPSSTPFGPDFRGGGEVCAGCES
PIADRFLLRVNERSWHETCVKCAVCLSALTGTCYCRDRLLYCKHDYEKLFIRKCSACLQV
IGRSELIMRVLGQVYHLGCFSCCECERRLQRGDEFVLKEGQLLCRMDYEKEREMLAAISP
APTESVKSEDEDGGGGSGSGKGGDEGKEHKRSKRPRTILTTQQRRAFKASFEVSAKPCRK
VRETLAAETGLTVRVVQVWFQNQRAKMKKIAEQEQLGGSRRGPSRGGRQSNDDSEDGSST
HGMDSMLGYPSLPRQQLLSLDPNIYGGEPFRHGLTPPQLNSEQIHSYDSETVFHDLDSDG
SLSHLGDCLLATGEAGLLAGRVGNPIDRLYSMQNSYFTS
Download sequence
Identical sequences A0A087XL61
ENSPFOP00000006514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]