SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006528 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006528
Domain Number 1 Region: 434-678
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.57e-59
Family Nuclear receptor ligand-binding domain 0.0000000302
Further Details:      
 
Domain Number 2 Region: 302-376
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.45e-20
Family Nuclear receptor 0.0000989
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006528   Gene: ENSPFOG00000006490   Transcript: ENSPFOT00000006540
Sequence length 681
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519676.1:1680854:1701056:1 gene:ENSPFOG00000006490 transcript:ENSPFOT00000006540 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRSRLPDRDETRMTERDRMETVDAYACPTLELSRAVSVSLGLDPLSSPLGGLNQCPSS
AFGDCEPAAAGGNSSCGAPELGTPGSVSSEGSRLVRADSSLGVDEFGEVCHGLRQVSCVD
QFSSGDMDAAQTVTRGSVISRFVCKDSSMFMNSIAEVPTTPQVTEVGSLKPYSPYSAEAN
LYRETQGVWCATERAYGERSEPHRGAYDGHSFLCKYCGQTSFGPRQECDCVWYRRGERGG
KGGAPVSTVQAFGQVESYPDAIPQGQSAFSTIKTEPSVWVHCTDRGFSHEDFFPGVFLSD
RRVCQVCGDDASGCHYGAVTCGSCKVFFKCVPPGKQNHLCASRNDCTIDKLRRKNCASCR
LKRCFMSGMSLKGRRLKGAGQTRGGEEEQQPGAWGHGEREGKHNVVLEPGNAAARAQGPQ
LLGIPPTMRSCLSLLTILQSIEPAVVNAGHDPAQPDSPASLLTSLNELGERQLVTVVRWA
KAIPGFRDLHVDDQMSVIQLSWMGVMVFALGWRSYTLTNCSMLYFAPDLVFNDQRMQVSS
MYEHCVRMKLLAQRFCKLEVTEEEFLCMKALVLFSIMPVEGLRSQRCFDELRTSYIKELD
RLASHHGETTRTQRLFQLTQLLDYLQSVVRKLHQFTYDLFIQAQSLQMRVNFPEMISEIV
SVHVPKILSGMVKPILFHNTA
Download sequence
Identical sequences A0A096LST0
ENSPFOP00000006528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]