SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006910 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006910
Domain Number 1 Region: 1053-1249
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.65e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000236
Further Details:      
 
Domain Number 2 Region: 833-962
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-28
Family Pleckstrin-homology domain (PH domain) 0.0000095
Further Details:      
 
Domain Number 3 Region: 46-71,98-169
Classification Level Classification E-value
Superfamily PDZ domain-like 2e-17
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006910   Gene: ENSPFOG00000006733   Transcript: ENSPFOT00000006922
Sequence length 1796
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519682.1:2117316:2198417:-1 gene:ENSPFOG00000006733 transcript:ENSPFOT00000006922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARWSDSPKDTKERKHSAVAPACQAKQKDGRDQSETSATVTPGADEEPFSWPGPKTLRL
RRTSQGFGFTLRHFIVYPPESAVHNSLKDDENGSRASPGRQKNRLEPMDTIFVKQVKEGG
PAHGAGLCTGDRLVKVNGESIIGKTYSQVIALIQNSDASLELCVMPKDEDILQLLTCGLQ
FSRDITALAYSQDAYLKGNEAYSGNAQNIPEPPPICYPRIELKAAAMAQPSDPGPARRPA
PTDNSSRPEVPSVSNDGTRTPADPVDRGSRLARAGPSHRTEENRYRSPADRPRPLTTGCP
PYPEMFSPLVRAPLAATSTDTFSTTTSPTANHCSPSPPAPTTSPHQNIDWRTYTTYKDYI
DAKRLHTYGCRTIQERLDSLRAATNSAYAPKTSAASQVRRRSASNERGPDPTAPPPLRSA
SQERLGGPPDRTSRHWPRSASQDALPFPGAARVAKPRARSCDHISHKMEDKQETSRRSLA
PPKPEQWLSNSPDVTKGTTDSALAVRADGLIMRPSRLPVKNSLCDLSPASSAIKTIEPLR
DQRANAVGNHLGFSPLNLQLRGRADSLKTENRSESGLAARSSSCSGAASRLPTLRPMKSE
VLTISSTATVTPKPVVKETPERTNGGLSEGVEGPDATVVVLRRDKTTGGARARPPSYIDR
QREVKSPPLVKAGSADAAMCWASNETLLRRLGDTRHKSGSSNLNDSLDSIPFIDEPSSPS
IDQDSMHIPASGLISTPLITTIPPSPTSSSPLIRRHLSHDQDSLHLSVIGSDSGTKSERS
KSYDEGIDNYHEESRGRSLLPGLKGLRFQAVDRSSEDSGSRRDSSSDVFCDATKEGLLHL
KQLHADKGKRVGGGNRQWKQMYAVLRGHYLCLYKDKKEGQAHASCQTIEEPLQISIKACL
IDISYSDTKRKNVLRLTTSDCEYLFQAEDREDMLAWIRVIQESSNLDEENAAFTSHDLIS
RRIKEYNTLMSPTGSKTEPSPRASRQSLSIRQTLLGGKGETKATSPHSPKPEQERKGIHK
DDTSPPKDKGTWRKGIPGLMRKPFEKKPSPGVTFGVRLDDCPPAQTNKFVPLIVEVCCKL
VEERGLEYTGIYRVPGNNAAISNMQEELNNKGMGDIDIQDDKWRDLNVISSLLKSFFRKL
PEPLFTNDRYADFIEANRIEDPMERLKVLKRLLHELPDHHYETLKFLSAHLKTVAENSEK
NKMEPRNLAIVFGPTLVRTTDDNMTHMVTHMPDQYKIVETLIQNYDWFFTDDGNGEPVTV
SHEESAIESQPVPNIDHLLTNIGRTGTSQGDVSDSPTSDSAKSKGSWGSGKDQCSRDLLV
SSIFAAASRKRGRSREKPQPSSSDDDLDAVFSRKEVPSGQKPNHHPLQGDKLRAEERKEN
GRTIHRNSLFQKEKTPPRRPSPSPIIGDQTAAQRKISLSDPLSQLEEITSDLGTMSSGAS
VPRSRPKKWTGGAFLDLSASAGAEVSSITSDYSTTSSITFLTGAESGVLSPELQGGEEAD
DERSELISEGRPMETDSEGEFPVFAPGGGSGQSTPRPTQSQEKPNAGAQKQEARRLFPTH
RMIECDTLSRRWSLRHKTDSDSSAEGAAGTEGRAESSSRLSRVLEVMKKGRSSSSISSSS
RSESERAEPAWHLKITERLRFRIRSSADDMFATKSQTPDARSKKKNIRRRHTMGGQRDFA
DLAVINDWREQGGVDQTADLSALGRLKPRCSSQDLSFRDWITHERLCGPEPSAAVAPKAE
PEDDHPEAPEKPPLATAEQVNGGGMRDTNKTAPTSDAHPHKLSGAQVTRSRFYQYL
Download sequence
Identical sequences A0A096MCK6
ENSPFOP00000006910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]