SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006953 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006953
Domain Number 1 Region: 1035-1231
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000288
Further Details:      
 
Domain Number 2 Region: 822-949
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-26
Family Pleckstrin-homology domain (PH domain) 0.000012
Further Details:      
 
Domain Number 3 Region: 44-164
Classification Level Classification E-value
Superfamily PDZ domain-like 1.58e-18
Family PDZ domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006953   Gene: ENSPFOG00000006967   Transcript: ENSPFOT00000006965
Sequence length 1789
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519714.1:1376608:1408778:-1 gene:ENSPFOG00000006967 transcript:ENSPFOT00000006965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASRWAPTEEDERHQARSSFCEKDSAERQSLADCPAVQYSTEEEPFAWPRPKTVRLRRTS
LGFGFTLRHFIVYPPESSLHCFPEEDCGRRGGRQRNRLEPMDTIFVKQVKEGGPAHEAGL
CTGDRIVKVNGASIIGKAYSKVITLIQDSGDVLELCVMPKDEDVLQLVRPFSKETTNLAY
SQDAYLRGYNSYSGNASHIPDPPVVCYPRVDCKPTGMAQATDPSGQVCRGPAASLDYGYR
KEITVPPSPPRQYSKSQTAVCMRNDSVRTVVVPPNSAHMGRVVSAQRVDFMDPAYVRGRP
GSLAQYPFPRKADIYPSGPGMVPFASQAPNYPSNHQNIDWRTYQTYREYIDNKGIHSHGS
RTIQERLDNFRIAGQPSFAAASHIPRGDWVPKGIRRRSTSHERSYHGPPPHFQAAPRSAS
QDRMRNSEKISNPRNWPPRSVSQDALVLKARSHSIDYVEPIELSRPSERRAGYPRADQGT
RPSRQAMPRNAVPFRPSAGYSSSMRGAPNPHFFSKGPDSLQTRSSPMLSDMLFGKSTEHS
FTNQRVSVPAHHLGHTSQPGQNRMRSETIQISEAGRDATVVGIRSSSSSAAREIPQRPGI
LKTAHQDSQSQVNGQSPSEPAVVMREKPHGGKNPSPLRHPSYILAVNDEGADSTADVAAC
WLPNDTRREIHMRRLEEQRHNSCSSNLDESLDAIPFIDEPVSPSVDREAAPIPPSAVISV
APSIATAPSSQGSPCPTIHRQLSHDQESMRSALLDSDSAGKTERSKSYDEGLDNYQEERR
GSTSKHMASFRGLRKTLDGHKPAGDSGSRRESSLDVFADSSKEGLLNFRQLSTDKNKRVG
GGMRSWKQMYAILQGHTLTLYKDKKDALSHAASQSDEDPLRISIKACLIDISYSETRRKN
VLRLTTSDCEYLFQAEGREDMLSWIRVIQENSNPDEENGSVTSQDLISRKIKEYNMMSSR
SEPSPKSSRQSLSIKQAFLGGKTEGRSHSSHSPRTGEDRRALKDESSPPRDRGAWKIGIA
GIMKKPFEKKQAGITFGVRLEDCPPAQTNRFVPLLVEVCCQVLEERGLEYTGIYRVPGNN
AAISNMQEELNTKGMADIDIQEDKWRDINVIGSLLKAFFRKLPEPLFTNEKYDKFIEASR
TEDSVERLKELKRLVYELPTHHLETLKFLCAHLKKVSDNCEQNKMEPRNLAIVFGPTLVR
TSEDNMTDMVNHMPDQCKIVENLVQQFDWFFMEDGSEDPVAVVEQESTVQSQPVPNIGHL
LTNISRVPASSSEVSDTACPDSNKSKGLWISGNQCSKEMLRSSIFANRKRKKNKEKSQLS
SSDDDLDSGFNKKELPEGGQQPLWSQVSQAEDSGQTDEDGEKDKHRNSSEETIRKDSESV
ASLPGEHIPSGHQMPPYASPSSSPNLNYRMAVTHQSSLSDPPSNYDDTVSDLGTMNSTSS
QASVPRARRNKSAVLGADACPGGLGAEVCSITSDYSTTSSMTFLTGAETCTLSPEVQSVS
ESRGGEDADDERSELISEGRPVETDSESDLSVFTIGKAEKSELPESTRPLPSHRLIECDT
LSRKKSSKQKTESETSLDDKDPSRLSQAVGSAKGRSSGSLSSSSRSEQDKTEPAWKLKIT
DRLKVRLRMSVDDMFGVGSQRSRSPEGRSKKKNIRRRHTMGGQRDFAELSVLGDWSQPVG
SRSELSAVDRLKPKCSSQDFSIGDWIARERHRTSNPEVSLDLSEQLGALCGSNSQNSGAP
SSSELARGPAEALNGEISQSKNLSLSATAHPHKLTSSQVVHSRFFSHFL
Download sequence
Identical sequences ENSPFOP00000006953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]