SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000006978 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000006978
Domain Number 1 Region: 362-534
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-52
Family SPRY domain 0.0000154
Further Details:      
 
Domain Number 2 Region: 143-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.51e-17
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Domain Number 3 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000129
Family RING finger domain, C3HC4 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000006978   Gene: ENSPFOG00000007051   Transcript: ENSPFOT00000006990
Sequence length 551
Comment pep:novel scaffold:PoeFor_5.1.2:KI519740.1:1594715:1597134:-1 gene:ENSPFOG00000007051 transcript:ENSPFOT00000006990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NMAASGLPPEDQLRCQICKNIFTSPVTLPCGDNLCKTCIPREWDHSVHCRCPICKEEFDK
RPQLQPNQDLSKMAACLKKSKDVNVNSTQSQQKVATLGDISCDECTGLKLKAVKSCLVCL
ASYCETHLKPHLMTKGLKKHQLLDPVENLEARMCSYHNKPLELFCRTDQTFTCMLCTLLD
HKEHDYLPLSEEAEQKRSVLRGTEETLNRMIQERRGKMQDLRHTSRLNQEAADGKAAVGL
QVFTDLKQNLQTGLDELLKNIEIKQVTAERLTERLIAELGQEVKVLMQSSADVQVLSSSA
DHAHVLRSFSSINNIPAMKDWSDVSVQIPLYEEMVRKAVVEAVDQLQATFKKEKAKLKEA
ELKRVQKFKVNLTLDPQTADPWLIVSDDGKQVRLGDFKKSVPDLPKRFNPGGGVVAQQSF
GFGRFYFEVQVTDMMKYDLGVVYESINRKKKITNSQESGHWILSLRKENEYKARASHEIP
LSLTHRPQRIGLFVDYEEGLVSFYDVGIAELIFSFTDCIFTERLYPFFNPGHGSRSSASL
KIGITSQSVTT
Download sequence
Identical sequences ENSPFOP00000006978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]