SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007234 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007234
Domain Number 1 Region: 379-558
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.22e-57
Family SPRY domain 0.00045
Further Details:      
 
Domain Number 2 Region: 10-82
Classification Level Classification E-value
Superfamily RING/U-box 1.48e-21
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 146-208
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.04e-16
Family B-box zinc-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007234   Gene: ENSPFOG00000007238   Transcript: ENSPFOT00000007246
Sequence length 558
Comment pep:novel scaffold:PoeFor_5.1.2:KI519637.1:896743:909236:-1 gene:ENSPFOG00000007238 transcript:ENSPFOT00000007246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGGVVLDKDQFNCSICLDVMKNPVTIPCGHSYCSDCIQNYWDQDDFLGVFVCPQCRQS
FSPRPVLARNTMLTDVVEKFKTTTLQAASVPRDNRCLAKADDVECDVCTGRKSKAVKSCL
VCLASYCDVHLQPHYESAAFKKHKLVSASKRLQETICPQHDKLLEVYCRTDSRCICYLCL
TDEHKGHDTVLAEAETQHIKMQLGDMRQSSQLKIQQREKEAQDLRQAVFSLARSARAAAE
ESDAIFTELIRQIELKRFEVRELIKEQEKTAIGEAEQLLDQIQKEIAELKKNEAELDLLS
HTDDPVQFLQSCQSVRASPALSASPLLNTNPSLSFSPVMTAVSDFKVLLQEVCQGGFVSI
YEKARDADIPYTTEPRKRADFLQYYNDLTLDMNTANSYLSVSDSRRSATTRIEPQPYPDH
PDRFTSWAQVLCRAGIAGRCYWEVEWAGSGGVSVGICYKNMSRIGGGSDCKLGHNSKSWS
LDCVNTTCSFQHNKESVAITTPCGSRIGVYLDFRAGTLTFYNVSDSMILLHKEKTTFTQP
VYPGFWVGLGSTLKVCSL
Download sequence
Identical sequences ENSPFOP00000007234

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]