SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007297 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007297
Domain Number 1 Region: 364-523
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-39
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily RING/U-box 8.73e-20
Family RING finger domain, C3HC4 0.0027
Further Details:      
 
Domain Number 3 Region: 134-196
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 3.82e-16
Family B-box zinc-binding domain 0.00065
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000007297
Domain Number - Region: 247-285
Classification Level Classification E-value
Superfamily Virus ectodomain 0.0956
Family Virus ectodomain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007297   Gene: ENSPFOG00000007385   Transcript: ENSPFOT00000007309
Sequence length 537
Comment pep:novel scaffold:PoeFor_5.1.2:KI519769.1:1201635:1203404:1 gene:ENSPFOG00000007385 transcript:ENSPFOT00000007309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASACSILYEEQVLCSICLGEFKEPVSTPCGHNFCKGCITQYWNSQDNAQCPLCKRRLGN
KPELKVNTEFRDVVEHFNRMRVQGGPKIVAQPGEVPCDVCTKPKLKAHKTCLVCLASYCK
PHLESHQNLKKHKLIDPVSNLEDRVCKKHDKMLELFCRTDQQCVCMMCLNDDHTGHEAVP
LERAFKDWRGMYENMTLKMKKTEIFSFLSVKNIRCFVEKSRETTVDEIRETVQILTAFVA
SVQKYQGELVEAIEQKQKDIEKQAEDQTTLLEQGISGVRRLRCDIEQLMQSEDYLYLLQN
YPFNVMSENTHLMDQPTDSILRMTQDIPDIGQQGHIEMVKKSVGQIEETLRNEMKMLIQK
DELMKIQQCNAVDVTLDPYTASNWLKVSGDGKRLTFRGHQQIFSSFFGRPFKYLPYVLAK
EGFSSGRFYYEVQVSNCKRWLVGVVKEYINREINSIPTPEDGAWILNTPRNMFLNQIQTI
GVFVDYEEAKVSFYDVEARSEICTFTEGSFIPKIYPVFGIYDYYYGDSLVISPVRKP
Download sequence
Identical sequences ENSPFOP00000007297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]