SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007450 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007450
Domain Number 1 Region: 371-459
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 1.01e-31
Family Small-conductance potassium channel 0.00012
Further Details:      
 
Domain Number 2 Region: 240-410
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-25
Family Voltage-gated potassium channels 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007450   Gene: ENSPFOG00000007485   Transcript: ENSPFOT00000007462
Sequence length 513
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519715.1:895392:922618:-1 gene:ENSPFOG00000007485 transcript:ENSPFOT00000007462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSPTREDGAAGSAQAEVGAAPAESRGGDGRGLVCALEMELTNRSLSSKMDCVSCDELIN
RNCADSPEVSVPLSALGKRVTHMEGDDLCRLIDRKFLIEDKKRLCALALGTALVGILLMI
IHAEICPYVYEPGSKVSLVINCSISLSTGCLLILIIAFHYKDIRLFIIDHKEVDWRIAIT
SHRVLVITLELLVCVIHPVGSYWEVNLYANSSSAAPLCISSHHDKALLDMELLLSMLMFL
RLYLVHRAILLHSKVLLSASYRSIGSLNNINFTFRFVLKVLMNKHPARTLLVFILLFWLT
ASWMLTLCERRSESLTTGQMDTALWLIAITFLTVGYGDVAPKTSCGKGVCLFTGVMGVAC
TAMLVAIVTEKLALNKGEKHVHFFMMDIQISKRIRHAAANVLRECWLLHRASPAKGSRDE
HRRHQRCLLEAIRVFRHLRLKQRKLRDYVSEMVDLPKMQMIMCDLSANWNNSYRELEQRI
LFMEQKLDELTRCFQQTSELLFEVLRHRNPEIR
Download sequence
Identical sequences A0A087XNU7
ENSPFOP00000007450 XP_007559609.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]