SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000007953 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000007953
Domain Number 1 Region: 347-466
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-33
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 138-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.7e-16
Family B-box zinc-binding domain 0.00068
Further Details:      
 
Domain Number 3 Region: 10-76
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000884
Family RING finger domain, C3HC4 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000007953
Domain Number - Region: 210-255
Classification Level Classification E-value
Superfamily Hypothetical protein YhaI 0.0222
Family Hypothetical protein YhaI 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000007953   Gene: ENSPFOG00000008035   Transcript: ENSPFOT00000007965
Sequence length 480
Comment pep:novel scaffold:PoeFor_5.1.2:KI519825.1:959515:961169:-1 gene:ENSPFOG00000008035 transcript:ENSPFOT00000007965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAASCLLSEEQFLCSICLDLFKDPLTTPCGHNFCKNCNTLGCKSLCPLCKRDFGARPEL
EINTFICEMVAQFKIKAQQKASGSSSEQQVAKPGEISCDLCSGTKLKALKSCLVCLLSYC
ETHLKPHLSESRLKKHQLMEPMKNLEEMLCKKHGKPLELFCKTDQTCICSLCSVLVHESH
RFVPLSHQYEAVRVELKKIEAELKKKIQTNRLKVQEIKEVLNICKDAADGEKAEGVQVFT
ALKESVEKALEELINEIEEKQKTTEKQAEVFVKDLEQEISELMKKSFEVKKLSQSEDHLS
LLSLKAALPTKKWTEISIHPPSYDETVVNFMSQMEVTTKKFYNEAELRRVQQYAVDVTLD
PATAHPALILSDDEKRVHCCQFTLYHNVFGKQGFSSGRFYFEAGVQGKNNWTLGVARESV
DRDGPIQLSPENGYWTVGLRRNKFMAFDDTCNGILCFPPPTKVGVFYLHHKTHFMIQYRV
Download sequence
Identical sequences ENSPFOP00000007953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]