SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000008230 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000008230
Domain Number 1 Region: 893-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000837
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 2 Region: 1046-1098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000017
Family Laminin-type module 0.0026
Further Details:      
 
Domain Number 3 Region: 1155-1203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 4 Region: 398-447
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000017
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 5 Region: 335-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000446
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 6 Region: 939-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000558
Family Laminin-type module 0.0048
Further Details:      
 
Domain Number 7 Region: 499-538
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000229
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 8 Region: 999-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000031
Family Laminin-type module 0.067
Further Details:      
 
Domain Number 9 Region: 268-324
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000314
Family Laminin-type module 0.044
Further Details:      
 
Domain Number 10 Region: 1203-1248
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000017
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1098-1152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 12 Region: 450-491
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family Laminin-type module 0.0096
Further Details:      
 
Domain Number 13 Region: 845-886
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000181
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 14 Region: 1342-1369,1474-1696
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0000575
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000008230   Gene: ENSPFOG00000008091   Transcript: ENSPFOT00000008242
Sequence length 1816
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519924.1:269249:286932:1 gene:ENSPFOG00000008091 transcript:ENSPFOT00000008242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RCLNMILIFVLVCLPAVKPQDLQDQCPGGSCHPQLGDLMVGRGTQLSASSTCGVDGPQNY
CIVGYLEGEKKCFTCDSRLPFSPQSNPQSHRIENVVTTFDSDRRLKWWQSENGVHQVSIQ
LDLETVFQFSHLVLTFKSFRPAAMLVERSKDFGRSWKVFRYFADDCSLHFPSVPAEPASF
IDDVVCDSRYSGPEPSTGGEVVLKALDPVFEIDDPYAPNIQELITLTNIRVNFTRLFTLG
DTLLARRRRNPQEKYYYSLYSMVVQGSCFCNGHASRCVPVDGGRGDVFTQPGMVHGRCVC
EHSTAGENCERCQPFHNDSPWKPGGQTTPNICRRCNCHGHSDSCHFDAARYEETGGVSGG
VCDDCRHDRTGPQCERCRPLMYQDPQRALEDPHACIPCDCDPAGSHSGGLCDASSGRCFC
KENVEGQRCDRCKHGFFDLRSDNPAGCEVCRCHGLGSVEPCDPLTGSCRCEPMATGPLCD
HCVAGFWGLGNSVFKCSPCDCDVGGASSNMCSPEDGQCSCLPNMVGRRCSDPAPGYFLPS
LIYFLYEAELAAQLTGGSPNLSDPLNLAAVQSWVQIPANISLCGCLSCVFSVLTCLQRPC
KVNPGLLPPCEQYFRRQGYHFQLSNGKVILIRRPRHLARRRRRVLQQNTSPPNQGPLQIL
PHQGSPEQSGTGLGLVRVTEGAGLRFTVDNLPTSMEYQLVIRYESESDSDWVARVNVITL
SPGDGGCSDDPPTGSLTLILPRSSRLGILDSRVCLNARGRYSVEIFFDRQQRSDNAPLLV
DSMGLVQSFYSVQEDFCSQSDFDSFSHSRCVGLDVYLGSQESLPKICEGLIKSLSARIHN
GAVACRCDVIGSLGSRCSMLGGSCECKPSVIGRCCDACAPLTFGFGPEGCKRCECDSQGS
LSEACDLSGGQCACRPRVSGRRCDRCESGFWGFPLCQPCDCNGLSETCDGQTGECVDCRE
HSSGRHCDRCVEGYYGNPVSRQPCQPCLCPDILSSGRFFASSCRYNPQSVSVSCSCREGH
AGERCDRCSPGFYGDLRLPGAACRACSCNNNIDPDDSDACDGTTGECLRCLHYTTGPQCQ
FCKPGYYGNALQHNCKECSCDRRGTKATLCPLEIPCFCDRRTGQCPCRTGVVGDLCDECE
DGFWNLDGTSGCQPCSCDPANSVSNVCDKVSGQCPCRPEFGGRQCDKCGENHFGNPDLQC
FSCDCNLEGTQRPSCDPETGECICRTGVSGILCDACAPGYSSEFPACEKCHECMVLWTEN
ITDVQRAAQRMRTFIPLHGNTQHPTHSQYWQRMLEMHSRLDSVGNMTGFSLPKMEKVEKL
YMKIRKLKDAVDTNIILIDPSVLLNNEINNINVEFQKMLKNLKDKLTKDPNKKETQPVEE
MLQEIQKLHKTFMSDEKRVRNSIKAVEDSMDTRQETKRKLSMCSGRADLATLEKKVKELN
VRQLNQKICGRPDPDDCSGCPEGQICDGAVPDAQKASEMAEKVKEQLIKFPSNLDESKKK
ISDVQQVAQDAKDQAQDLQRQLSATTESLEREKNQTRELLQRVKQYLMDEMVPPGDIEKM
ANAVLRIQLPRSPAEIQSMINEISNLLNDATKFQEDLKKLQDEAKTAQELLQKATEAKEQ
TTNIDVKDIVSDIIAADAAQSKANDDLEVANKDRDDAEDLIQEAGNKLNRIEDKLMNQPV
GLLEEIEALKNKTEQNREMAKEARETAESALTNVSNDAQELQEVEEQFELLKQKHLNKTL
EDEAADRLQEILKETEDMQRQMEDRLQQIEDLEQKIQLLIQTKEEKVVEVVELLQTVESL
QKEIASKAEYYTTCSS
Download sequence
Identical sequences A0A087XR27
ENSPFOP00000008230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]