SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000008525 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000008525
Domain Number 1 Region: 290-544
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-61
Family Nuclear receptor ligand-binding domain 0.0000487
Further Details:      
 
Domain Number 2 Region: 94-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.81e-29
Family Nuclear receptor 0.0000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000008525   Gene: ENSPFOG00000008509   Transcript: ENSPFOT00000008537
Sequence length 547
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519949.1:391779:396596:1 gene:ENSPFOG00000008509 transcript:ENSPFOT00000008537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLCPPAGGVISYVGSCGGSPSRGSPDCGASPDSMDSENSDAGFASSSSSLPSFLSSDAAG
GSPQGRDDAADTTGPHRASPSKSVASLTKLNGMVLLCKVCGDVASGFHYGVHACEGCKGF
FRRSIQQNIQYKKCVKSESCSIMRTNRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQR
MLAEMQSSMNNMVNDQLQSDFQLASLSSSSSSSPEGAIDPQPSPPLPPPSSPPPSPGIDS
TISAIACAHRETFLYAHDKLSEPQLSPAHRHPGEAELCPNRNGFSKNNNHKNTMDCFLQQ
GHNNTSNYHGNKGWSQHSSTVIGGQSHVTQHQSCPPKSRSGIVLACPMNLQPHADPLKTP
QEIWEDFSLSFTPAVREVVEFAKHIPGFNGLTQNDQVTLLKAGTFEVLMVRFSSLFNMKE
QTVTFVSGTTYSLEELHAMGMNELLAAMFDFSQKLASLALSAEELGLFTAVVLVSADRSG
IENLPSVEHLQENLIRALRCLVNNTAGAGKPPVMDSPRFTKLLLRLPDLRTLNNMHSEKL
LSFRIDP
Download sequence
Identical sequences ENSPFOP00000008525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]