SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000008628 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000008628
Domain Number 1 Region: 359-527
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-48
Family SPRY domain 0.00089
Further Details:      
 
Domain Number 2 Region: 11-83
Classification Level Classification E-value
Superfamily RING/U-box 2.05e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 143-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000143
Family B-box zinc-binding domain 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000008628
Domain Number - Region: 191-262
Classification Level Classification E-value
Superfamily BAG domain 0.0251
Family BAG domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000008628   Gene: ENSPFOG00000008689   Transcript: ENSPFOT00000008640
Sequence length 534
Comment pep:novel scaffold:PoeFor_5.1.2:KI520212.1:2615:4279:1 gene:ENSPFOG00000008689 transcript:ENSPFOT00000008640 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAGMEQNQLDQETFSCPICLDLLKDPVTIPCGHSYCMSCIEIHWDEEDQRRIHSCPQCRE
TFIPRPAVKKNTMFAALVEQMRKTGLQAAPADHCYAGPEDVACDSCTGRKLKARKSCLIC
LASFCEKHLQPHYDSAAFQKHKLVEPSNNLQENFCSKHDKLLEIFCRTDQKCICYLCTMD
EHRGHETVSAAAERTKDVKLLQQEVEAINHSADKTVEDSEEIFTDMIRLLQKRSSDVKQQ
IRSQQETEVSRVKDVQEKLEQEITELKRKDAELEQLSHTEDHSQFLLNYPSLPALRESTH
SSSINIRPLRHFEDVTAAVSELREKLQDVLRDSWTNISLMVGEVDVLLSEPEPKSRAGFL
KYSCEITLDPNSAHTQLGLSEGNRKVTRMNQHQLYSSHPDRFTNYSQVLSRESLTGRCYW
EVKWTGSVCVAVAYKNISRAGGELECRFGRNDKSWALDCQQKGFKFVHKSIWTSISGPVS
SRLGVYLDLRAGLLSFYCVSETMTLIHRVQTTFSQPLHAGVGVGLGSSAEFSKP
Download sequence
Identical sequences ENSPFOP00000008628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]