SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000008823 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000008823
Domain Number 1 Region: 424-596
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-51
Family SPRY domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 8-77
Classification Level Classification E-value
Superfamily RING/U-box 3.74e-19
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 3 Region: 163-219
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000275
Family B-box zinc-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000008823   Gene: ENSPFOG00000008762   Transcript: ENSPFOT00000008835
Sequence length 609
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519949.1:442312:449342:1 gene:ENSPFOG00000008762 transcript:ENSPFOT00000008835 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAPQLFSEQELTCSICLDLFTDPVSTPCGHNFCQACIGGYWASSSVCTCPLCKRQFDERP
QLSINKVFALIADKFKQTRYGATGFSAPVGNGSLDAMEDGRSTNPFLSPLPAPAALGDVV
WCDVCSGVKQPAVSSCLTCTASYCSEHLQPHYNTAFYAKHPLLDPQEALRGRTCSTHRRL
MEVYCKTCQRCICAICVLQDHRTHKTVSVQTERLSKQKLVARTEQEILNCIKEKEIRLSD
LKRKLESVQNYADKERGDVEHLLDEVSASLDRIRTQVVGGIQNQLEAVTSKGETMVHRLE
AELSQLTDRRATLEVQAISQDHISFLQSFEEATAPLDEKKHDDADEEAELSLHFHLDDVK
SSLSDVKIKVDEIWMGEIRPRASRGDLMAAESMMSLRGSKSTLRMSQWSLKDMKKSKHVT
GLKKARAYIEDVTLNPVTAYPFLILSEDRKQLKRGEKLQFFRNSHHRFDVWSCVIAKEGF
SSGRHYWEVSVGENKDWKLGVVTESAQRKGLFDMSPTNGYYAIWWCGSQLRALTTPPLTK
VKGHHPKLRQVGIFLDVEEGQVSFYNVKSGTEIYSFHTNTEFTERMFPLLGTGDKEVPLI
LATAQHHPA
Download sequence
Identical sequences ENSPFOP00000008823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]