SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009065 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009065
Domain Number 1 Region: 297-467
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-45
Family SPRY domain 0.00046
Further Details:      
 
Domain Number 2 Region: 22-94
Classification Level Classification E-value
Superfamily RING/U-box 3.33e-21
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 157-191
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000504
Family B-box zinc-binding domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009065   Gene: ENSPFOG00000009116   Transcript: ENSPFOT00000009077
Sequence length 474
Comment pep:novel scaffold:PoeFor_5.1.2:KI519642.1:1313491:1314960:1 gene:ENSPFOG00000009116 transcript:ENSPFOT00000009077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKYSESFSLRGKMAQAGVQLDRKRFSCSICLDLLKDPVTTSCGHSYCMSCIKDHWDIEDQ
KGTHSCPQCRKTFNRRPDLQKNTLLAELVEDLKKTGLQHAPADHCYAGPGDVACDVCTGR
KMKAVKSCLVCLASYCEDHLQPHYESHAFKKHKLVKASAVPQQHVCIRHDEVMKIFCRTD
QQSICYLCTMELTLEFLLCCDKICKFVCDNIIKSLSPSDLLMFLYETAKSSSVPLHSASH
QTLSADDRPLRHFEDVTTAMSELRDKLQDILRDMRTNLPKTVPLVDVLLSEPEPKTRTDF
LKYSKRITLDPNTANNFLLLSEGNRKVTLVEEDQFYFDHPDRFSNCTQILSRESLTGHCY
WEVEWRGTEVDLAVSYKNISRSEGDSDFRNTDKSWTLYCHRQIYIFYHNRVETQVLVPVS
SRVGVYLDHRAGVLSFYHVSGTMTLLHRVQTCFTQPLHAGVGFYSYGDSAKFIE
Download sequence
Identical sequences ENSPFOP00000009065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]