SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009324 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009324
Domain Number 1 Region: 222-345
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 8.76e-58
Family Dystroglycan, domain 2 0.00000147
Further Details:      
 
Domain Number 2 Region: 467-569
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000107
Family Dystroglycan, N-terminal domain 0.017
Further Details:      
 
Domain Number 3 Region: 107-197
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000124
Family Dystroglycan, N-terminal domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009324   Gene: ENSPFOG00000009372   Transcript: ENSPFOT00000009337
Sequence length 863
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520207.1:144623:166631:1 gene:ENSPFOG00000009372 transcript:ENSPFOT00000009337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSEGGVGWLRGVRGHGGTLPRTRVWLLVLLLAAAGWTPPAARAELELDMLGGLVLLEAG
GDGEELGGDLEASMHSSLLQDFQEAMDSRRAAEPGSVAASRQEAAASSAFPDSSAAVGRV
FQIKVPNKMEDVHLGDIVKVTEVGKDSLPAWLHWDGGSSVLRGLPLEEDKGVHYISVTIS
NHTSSSSEEFSIEVHTDDHFDGDPSVPLSGPAAAEDPVQPFVCSNEEPVTVLTVILDADL
TKMSSAQRVELLDRMRSFSGVELQGMKMLPVVNNRLFDMSAFMAGPGNAKKVVENGALLS
WKLGCFLDRTTVPDINSVQGPAKDGSMSARLGYPVVGWHIANKKPQIPKRVRRQLNNTPT
PVLAVLPPTTAAEPPVRIVPTLSSPSIAAPTESSAPPVRGPVPLPGKPTIRIRDPIAHTP
TLGPPQPTKVVVTTSTVSIQPSMSRKIPVEPASTLSPGVIDDPNNKKPVLRNPIDQVVAL
VGTYFEVKIPSDTFFDKEDGTTDKLRLSLKQNHKDVVGEESWIQFNTTSQLLYGLPDVQH
LGKHEYFMQATDKGGRNAIDAFEVKVNRWPANDKTPVIFTARFEGEPRLITNNIHKKILL
VKKLAYVLGDRNSSTVSLRNISKGSIVVEWTNTSLPQHLCPKEQLRNMSRTLGDADGRPT
QKFRNYMGPDFSPLEVKVRGRASCRMYSFIPPAEVDIPEPSMVTPGLGSSRHSTDDVYLH
TVIPAVVVAAILLIAGIIAMICYRKKRRGKLTIEDQATFIKKGVPIIFADELDDSKPPPS
SSMPLILQEEKPPLPPPEYPNMASPETTPLNQEMLGEYTALRDEDPNAPPYQPPPPFTAP
QEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSPFOP00000009324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]