SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009355 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009355
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily PH domain-like 4.3e-32
Family Phosphotyrosine-binding domain (PTB) 0.0000122
Further Details:      
 
Domain Number 2 Region: 265-364
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-27
Family SH2 domain 0.0000124
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009355   Gene: ENSPFOG00000009389   Transcript: ENSPFOT00000009368
Sequence length 370
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519710.1:1218859:1250826:-1 gene:ENSPFOG00000009389 transcript:ENSPFOT00000009368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSINLNISTSSLNLMTPDCKQIIANHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHI
LECSDGLAQDVISTIGQAFDLRFQQYLQCPSSKMSSVHDRVLNMEELAWTEEEEESTEHP
YYNNIPGKMPPQGGFIDSRLTNQNADQTGPGSVDQTYYQGRHFFQYSGSFDISGFPENKG
QTPKAAEMPMYVNTQQIDAQVLAALQAEAENATKGIVEAGKESPQKDLFDMSPLAPGQSQ
TQVSNLQKAASVDNSSPLLVRSLAFRAQEELEGQTWYHGKMSRRDAEKLLKSDGDFLVRT
STTNPGSYVLTGMHNGLSKHLLLVDPEGTVRTKDHIFDSISHLIGHHRDNNLPIVSAGSE
LCLHQPVERK
Download sequence
Identical sequences ENSPFOP00000009355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]