SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009365 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009365
Domain Number 1 Region: 331-466
Classification Level Classification E-value
Superfamily C-type lectin-like 9.28e-42
Family C-type lectin domain 0.0000984
Further Details:      
 
Domain Number 2 Region: 783-912
Classification Level Classification E-value
Superfamily C-type lectin-like 8.42e-35
Family C-type lectin domain 0.00049
Further Details:      
 
Domain Number 3 Region: 190-320
Classification Level Classification E-value
Superfamily C-type lectin-like 4.48e-34
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 4 Region: 924-1077
Classification Level Classification E-value
Superfamily C-type lectin-like 4.31e-33
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 5 Region: 476-610
Classification Level Classification E-value
Superfamily C-type lectin-like 1.43e-32
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 6 Region: 624-768
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-31
Family C-type lectin domain 0.00031
Further Details:      
 
Domain Number 7 Region: 1090-1205
Classification Level Classification E-value
Superfamily C-type lectin-like 8.57e-26
Family C-type lectin domain 0.00094
Further Details:      
 
Domain Number 8 Region: 1223-1358
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-23
Family C-type lectin domain 0.0038
Further Details:      
 
Domain Number 9 Region: 129-187
Classification Level Classification E-value
Superfamily Kringle-like 9.99e-21
Family Fibronectin type II module 0.00069
Further Details:      
 
Domain Number 10 Region: 2-129
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.09e-17
Family Cysteine rich domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009365   Gene: ENSPFOG00000008982   Transcript: ENSPFOT00000009378
Sequence length 1440
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519704.1:444637:461928:-1 gene:ENSPFOG00000008982 transcript:ENSPFOT00000009378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DSDDFAFFLEGTSMCLGVMTDSLSLTADCEDPLQRWKWVSRGRLFNLGSSLCLGLNTRNL
TYNSQYPPIAIYTCDREPPRVDWTWNCDEVLEKLNNFFQSPAFFNGSTMFGSAKWRLYGD
DQDLCSKTYQEIYTIQGNSYGRPCYLPFMYEGQWFHSCTSTGREDGHLWCGTTFNYDRDQ
RWGFCPVKSSSCETFWDTDPLTDSCYQFNFQATLSWSEAQRSCKQQGADLLSIGKLHEQT
YINGILNAYSSSLWIGLNDLDISGGWQWSDSSPVKYLNWDKEHPTHAEDDNCAVVQSESS
GRWQNRDCTEALPYACKKKPNATLEPFTTDSWTDNHKYECDVGWQSFQAGCYKLSSDKSE
WNAAQKACQKMDANLVSIHTLPELEFIIRNLKKDIDQVWIGLHDREMQMDFQWTDHTPVI
FTFWHPYEPNNFRNTQEDCVSMWGPEARWDDVPCNATLPFICKKPGTKSDGKPQNQECKQ
GWKWHSPACYSVGEDLSTFDEARKSCEAHEAALITITNRFEQAFASSLVFGRSGDSFWIG
LSDQVSHGSFRWLSGDEVTYTHWNRDQPTNVRGGCVVMATGSAMGLWEVKECASAKAKFI
CRQNQDTSLSPEPPAPQPTPSLSGACPKDWKSNSNLRYCYKVFHSSQLEQKLKWLDAHLF
CRKHGANLLSISSPEEEQFVLQVLHENFGVNTHRESEEHEQHWFWIGLNRRNPMDNGSWK
WSDGLPLTYRNFGRYHYNIRQCAAADLGTMTWLAMHCDSELDWICKIPRGSVELEPEVTE
GNTAPEWITFQEAQYRFFDHRTTWDQAQRICSWFDSSLASVHSAEEQAFLANNLSKVLKK
SEPSWWLGLHTYENDGRFRWSDHSVLNYVSWALGKPQPVSRDRKCIYMSTSKGDWADQKC
HSDLPYICKQVKDTGTIPPTPSSPHPPSGCPTGWSPYQHKCFKVFESTRVTWSAAKLKCE
SQRGTLALVSNHLDQAFITTLLKNVSTDLWVGLTSDSKGHFRWTKTGLLSYTNWAPGEPV
DNSGPHHNKTPGNCVVMIHGNPERKTGMWASRACEMTPLENNGFICQKQPDRSLPPAPAL
IPSSLSEPVELGGVTYRVVQKRLDWTGALYLCESLNGTLAVVKDPYQQAYLTLLISSLHQ
PAWISLYNYGGRSFTWLGDEEVKYSNWKDGQPNQMAGCGHMTTTGQWTMTPCDAKLDAAI
CQISDEPVSHQWIYPGLCPHSVGEWAWVPFRNHCYAFNLQLLKLQQDALASCKKMGAELL
SILDEAENSFIWEHIQSYAEQAKGAWLGISITLRAAVTERRLVWNEDTEMSFTNWETRKV
AFSMLSINSCFLIQSNSGRWTPDSCRNRTHGVICKRPRTLKIASFSPVDVDHLPTLIVVI
VTALVLLLLIATVIYLYRRRTAGSRGSFEGARYSRTNSGLDEQAEKNILVSDMELNEQPE
Download sequence
Identical sequences ENSPFOP00000009365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]