SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009498 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009498
Domain Number 1 Region: 425-600
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-51
Family SPRY domain 0.00048
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily RING/U-box 1.46e-19
Family RING finger domain, C3HC4 0.0079
Further Details:      
 
Domain Number 3 Region: 136-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.27e-16
Family B-box zinc-binding domain 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009498   Gene: ENSPFOG00000009548   Transcript: ENSPFOT00000009511
Sequence length 610
Comment pep:novel scaffold:PoeFor_5.1.2:KI519655.1:126295:138052:-1 gene:ENSPFOG00000009548 transcript:ENSPFOT00000009511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLDRETFSCSICLDLLKDPVTTTCGHSYCMNCIKGYWDKEDQKRIHSCPQCRKTFTPRPV
LQKSTMLAALVEQLQKTGLQAAAADHCYAGPEDVACNFCTGRKLKAIKSCLFCLVSYCEK
HLQPHYEVAHLKKHKLVEPSKNLQENICSTHDEVKKMFCRTDQKCVCAFCLLEEHRGHDT
VSAAAERAERQRELEERRGNIQQRIQNRGKDVKEEKEKVLFINRSAKKSVEACEKICTEL
IRQIKKKSSDVKKYIEAKQKTEVCEAEFKKEITELKREDAELEKLSHTEDDIQFLKKDSP
CFRMPCIPPPWCLDKIKAAVSEAESTIEEIVGNRFTQPLLAGIRLYETGGSAEFSQLRRQ
LREEMCKVLIYYCQTSFCPLDTSDKMVLLEFSAIQTGNTLFQAAEISILSSPPPVTLGNK
NSHEVKLTYSCKITLDPNTAHTMLVLSEGNRKVTRMDQHQIYPNHPDRFTDWCQVLSRES
LTGRCYWEVEWSGKRVYIAVTYKNISRAGDGNECRFGYNDKSWAVNHYKDIYRYESNFLH
NNIWTSISAPRSSRVGVYLDHRAGLLSFYSVSESMTLSHRVQTRFTEPLHAGVWVCNTGG
SAEFCKLKQK
Download sequence
Identical sequences ENSPFOP00000009498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]