SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000009690 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000009690
Domain Number 1 Region: 1424-1501
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000407
Family SH3-domain 0.0017
Further Details:      
 
Domain Number 2 Region: 990-1168
Classification Level Classification E-value
Superfamily RUN domain-like 0.000000301
Family RUN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000009690   Gene: ENSPFOG00000009557   Transcript: ENSPFOT00000009703
Sequence length 1516
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519630.1:1076233:1093101:1 gene:ENSPFOG00000009557 transcript:ENSPFOT00000009703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSPPKVSGETLIVHHIPLMHCQVSGGCGGSLKRTNPFSPPESLGLSRTTSLPERDVLQR
EALLYSSLIQTSSGSWSSSGGVGREKRGGGGRGGSTASNPFLLNTDEDEDEEDEDDSDNL
HGYLEDSSFHLHSKTNAALDDAMAPFLGFASEPFLLHGSGAVSSRESLRGASSDLSNHLD
DLDVLGLDRERRHGSSGSNVSMDCGEHDWVDDEEDDDQPMRCGQSSKTGSYSSGSSNQHC
SCCALSQNFPETFAEPFPDFQQGYCSDSSCNSSEGVLINFSAIYNKMNNGIPEKQPPPAG
TSSVSDLHGNQQDARGGGAFYLDLHTSPTEPPPSCFSNAFPLIREPRLSSSSACSCSMEH
QATLDLDANCNSFHPPHAAGSSGDLASCLQSQARLVVATQNYYKLVTCDLSSQSSPSPAG
SSVNSCSSEHSKGSPTPTQPSEYFLFRQRGEEQGLEEEDEDGASSRDAEAAGVAPSVIEG
QVYVNISPPMAQRSIIGGSGAPSGGRPRSRSYDRNLDRCPSPRLGSLERMLSCPMRLSDV
TSFAEIARSKRRHGGAGGSPSTKAAADPFSSTYSTHSHSSVDFSPILEQRVESVSPAALP
PGKHRAPPGRGEGEPDQGRRYVPPITLKQGVQTQLRPLWPRGAAAPRSDGGGPAFSEKQR
NKMWGVLSSSSESPPAVVRYSKDQRPTTLPIQPFTFHHQFTSKPPQPKPLLPLLTGYVSG
MQARPCSGSGSGSGGPVGEESEEAAEIGHGYQSSRSATAPPTESVRPSPLGSYSPVRLQG
ALSSGSCSTCTPSPKPAHSLSCPLSAGLGSLHTPPAGRHGNGSVPLAHTPPPPTLGVKAL
HTDTLSPLGCLDSGKLSDRGKGSGSRTQNVHHLSPQALKWREYRRRNPLGVERAPGGHSA
ASMELRRAGGPRPARRNVFDFPTVWSAKIHNHRLSGQSAKLQQSYSDFLPDYFSLTEKPP
EEFCLSPDASTSSSCYSSQSHVSVDLTQKRGLVKAVNTAVDLIVAHFGTSRDPDVKAKLG
NSWVSPNVGHLILKYLCPALRDLLQDGLKAYVLDLIIGQRRCQPWSVVEASTQLGPSTRV
LHSLFSKVSQFSELTSHSMRLNAFVFGLLNMKSLEFWFNHLYTHEDIIVAHYSPGGFLPL
SQGPCKPLFEELLLLLQPLSLLPFDLDLLFEPHLLQKGQEQLRRKEQLRSAGPASRSTFQ
LMRGWSTTVGDVARSERPGLRREGTWPGMERDGATAGASLWKERAKDVKERDRRKEKDPG
HKQAGWWYQLMQSSQVYIDQSAEGSKFVKAEKRKKSSERRQNQPPPAREGVVEGAESEGE
RGASGGESRGRPSWMGSPPESILNREKDPNLAEDTGVEIQDESPSQGQSLRWGRLFGSTR
AESAELRARAQKTRPPSGWLSLDRSILDLVAVTIGAGGAKKAEPPTTPTHGQTTAPLPLT
ETKQSSSCEVRALCHHLATDPGQLSFNKGDVLRVLRKADPDWLLCSLGSTRGLVPIIYVT
LSSMEDSRSETGLSQL
Download sequence
Identical sequences ENSPFOP00000009690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]