SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000010332 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000010332
Domain Number 1 Region: 359-536
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-44
Family SPRY domain 0.00095
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily RING/U-box 2.43e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 137-199
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000321
Family B-box zinc-binding domain 0.00047
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000010332
Domain Number - Region: 183-286
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0262
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000010332   Gene: ENSPFOG00000010358   Transcript: ENSPFOT00000010347
Sequence length 548
Comment pep:novel scaffold:PoeFor_5.1.2:KI520009.1:495285:498475:1 gene:ENSPFOG00000010358 transcript:ENSPFOT00000010347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQPGLKLEQEKLSCSICLDLMKDPTTIPCGHSYCLNCIGRYWDAEESPSCPQCRQSFSP
RPVLVRSSVLADLVEERRRSGGPPAAPDEPSQDVLCDFCSEEKQKAVKSCLQCLVSFCEQ
HLQPHFSISALKKHKLVEPSQQLENSVCPLHSEVMKIFCRTDQSCICYLCLMDEHKGHQT
LSAAAEMSNKQKELAAHRQDVQRRIQGRQQEVEKLQQVEKDIHQSADEALRNAEKIFTAV
KQQLRSQQESEVNKVKELQEALEEEIRGLRRTAAMLEELQQTSDHIRFLQNYGSLARLGE
ASDPSRIDVQPESFRRDAEETVSELRDRLEELLTEEWSPVPPTGPDVEVLVPQAEPQTRG
EFLQYACPLTLDLNTANMCVRCDYPLKAYSHRINGILVDHPDKFSYWPQILCSESLTGRC
YWEVEWKASSNRWDVFIAVSYKDISRKGDESAFGNNKKSWALQCYNKSYEFRHNWIRTPV
SGPFSSRIGVYLDHSAGVLSFYSVSDNNMSLLHRVQTTFTRPLCPGFGLYDSASAQIWDL
WSDWYLFD
Download sequence
Identical sequences A0A087XX29
ENSPFOP00000010332 XP_007576226.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]