SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000010640 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000010640
Domain Number 1 Region: 270-340
Classification Level Classification E-value
Superfamily Homeodomain-like 3.59e-20
Family Homeodomain 0.0022
Further Details:      
 
Domain Number 2 Region: 109-177
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000547
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 77-108
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000323
Family LIM domain 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000010640
Domain Number - Region: 171-203
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00381
Family LIM domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000010640   Gene: ENSPFOG00000010594   Transcript: ENSPFOT00000010655
Sequence length 408
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519957.1:182936:189801:1 gene:ENSPFOG00000010594 transcript:ENSPFOT00000010655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTGRSAEARYMEVVSCKTEASSCTLCPGPGAMLFHGISGDHIQGIMEEMERRTKTESRLA
KGMQLNGRESTMTSMSPEKPALCAGCGGKISDRYYLLAVDKQWHLRCLKCCECKLALESE
LTCFAKDGSIYCKEDYYRRFSVQRCARCHLGISASEMVMRARDSVYHLSCFTCTTCNKTL
TTGDHFGMKDSLVYCRLHFETLVQGPDYHPQLNFAELAAKGGGLALPYFNGTGTAQKGRP
RKRKSPAMGIDIPSYNTALTGCNENDTDHLDRDQQAYAPTQKTKRMRTSFKHHQLRTMKS
YFAINHNPDAKDLKQLAQKTGLTKRVLQVWFQNARAKFRRNVLRQENGGVDKADGTSLPP
PSSDSGASSAATLTDLTNPSITVVTSVTSSLDSHDSGSPSQTTLTNLF
Download sequence
Identical sequences ENSPFOP00000010640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]