SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000010678 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000010678
Domain Number 1 Region: 194-394
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-52
Family DBL homology domain (DH-domain) 0.000000473
Further Details:      
 
Domain Number 2 Region: 2-231
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.7e-42
Family Calponin-homology domain, CH-domain 0.0034
Further Details:      
 
Domain Number 3 Region: 381-542
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-30
Family Pleckstrin-homology domain (PH domain) 0.0063
Further Details:      
 
Domain Number 4 Region: 634-764
Classification Level Classification E-value
Superfamily SH2 domain 4.57e-26
Family SH2 domain 0.0009
Further Details:      
 
Domain Number 5 Region: 792-860
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-21
Family SH3-domain 0.00094
Further Details:      
 
Domain Number 6 Region: 590-663
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000401
Family SH3-domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000010678   Gene: ENSPFOG00000010450   Transcript: ENSPFOT00000010693
Sequence length 862
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519766.1:1349569:1410062:-1 gene:ENSPFOG00000010450 transcript:ENSPFOT00000010693 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYWRQCAVWLIGCNVLPANHRVTADTAQVFDLAQTLRDGVLLCQLLNNLKPHTINLKEI
NLRPQMSQFLCLKNIRTFLSSCCDVFGMKKSDLFEAFDLFDVRDFGKVMDTLSKLSHTAI
AQQGGFKPFPLEESLKDEEIYNNLEDLLESACGHDEKDLYAAVYGLEDEYAGGEIYEDLM
KTEQHAPLKQAEVDVRSCCLSEIKQTEERYTETLESIEKYFLNPLKKFFSAAEIDKVFVN
IPDLVKVHKSLMGDLQDSILNKNALNLYQIFISYKERLLIYGIYCSRVEIAIAVLDLICK
EKEDVRLKLEECSKRANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTHDAADKSNLKIA
LDAMKDLAQYVNEVKRDNETLREIDQYQRSIENLNQSLVTFGRPKGDGEVRLVSNVDKRK
QDRHIFLFDVAAIVCKRRGDNYEMKDILDLNFFKVTNNPTADREGKKWCYGFFVTHQQGH
MGFELFFKTKELKKKWLDQFEMAISNIRPEKANHNSHQFKMHTFERITSCSYCHLLLRGI
FNQGYRCQKCGLGAHKECLGRLGACGRTVSVSHLPADPVKLRPKENAAPPGPGLPRMIVI
RDYSGIPSPLCGPPLSIQAGDVIELMFADLHSSWWQGKILATSKTGFFPSDAVRPYPCVP
KPVDYSSQLWFAGLMERYQAEVELIDRGNSTYLVRHRSKDCNEYAISIKFNDKVKHIKIL
TKDGCFYIAESRLFKTVLDLVEYYKKHSLKEGFSSLDTTLQVPYRELSNGNMPKAITKVG
NVPSGGCGFVPPSFSPFWSVISPRIVGIAVARYDFSSRDTRELSLQQGDTIRIYTKMTNG
WWRGEVDGKVGWFPSTYVDEED
Download sequence
Identical sequences ENSPFOP00000010678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]