SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000010750 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000010750
Domain Number 1 Region: 382-564
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.12e-65
Family SPRY domain 0.00000931
Further Details:      
 
Domain Number 2 Region: 12-88
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-21
Family RING finger domain, C3HC4 0.005
Further Details:      
 
Domain Number 3 Region: 158-209
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000824
Family B-box zinc-binding domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000010750   Gene: ENSPFOG00000010740   Transcript: ENSPFOT00000010765
Sequence length 569
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519774.1:1099415:1112705:1 gene:ENSPFOG00000010740 transcript:ENSPFOT00000010765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAMALSSAFLSEDQFTCSICLEMFNNPVSTPCGHSFCQSCLSSYWDSRGRGQAAKAYQCP
LCKESFSKRPDLQINRTLKEITEQFKQMSQSAGGAGGGGEHLGLRAQHSGPSPPVRPGEM
PERLLVEMMARFQGLTPPSPHQGFQTQNNHDLPPPYSPPLSHSNLPLCPIHMRGLEFFCR
TDNETADHRGHSVAPAQREWHIKMSQLGIHEMELKELICVRERKVEEIRNSIREIKAAAE
TETDGVVCALTKLISTVEHCQSRILEVIEMTVLTAESRAQSLLKELEEEITALKKRSATL
SQLAVSEDYVQFFRTFPALSSPPQAKDWSNVSVSSQSTSEGILRTVSQMVERLQLDMLNL
PEPCKQQPSPAPPLPRPIPRIRRIQEYAEDITLDPGTAHPRLIISADGKQVQCGDRHQLV
PDNPERFDRVVCVMAHQGFTSGRHYWEVDVGSKTDWDLGIASRSVIRKGKIPVSPAHGYW
FLSLRDRTDYAFRTDPATSLTVATRPSRVGIYIDCEKGLVSFYNVEAKLVIFTYTDSFKD
TIHPFFSPCTNKSGQNAAPLVICPIAITE
Download sequence
Identical sequences ENSPFOP00000010750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]