SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011200 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011200
Domain Number 1 Region: 125-327
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-52
Family DBL homology domain (DH-domain) 0.00000191
Further Details:      
 
Domain Number 2 Region: 314-476
Classification Level Classification E-value
Superfamily PH domain-like 1.55e-34
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 
Domain Number 3 Region: 598-698,775-801
Classification Level Classification E-value
Superfamily SH2 domain 2.14e-23
Family SH2 domain 0.00068
Further Details:      
 
Domain Number 4 Region: 727-803
Classification Level Classification E-value
Superfamily SH3-domain 7.34e-19
Family SH3-domain 0.00082
Further Details:      
 
Domain Number 5 Region: 515-579
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000906
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 6 Region: 1-149
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000149
Family Calponin-homology domain, CH-domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011200   Gene: ENSPFOG00000010751   Transcript: ENSPFOT00000011216
Sequence length 807
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519739.1:439793:629567:-1 gene:ENSPFOG00000010751 transcript:ENSPFOT00000011216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISALSRISHHSIAQIKG
IRPFPSEDTALNEDDVYRSLEELADEHDLGEDDIYDCVPCEDDGDDIYEDIIKVEVRQPM
KMGMTEDDKRNCCLVEIQETESKYYKTLEDIEKNYMIPLKQVLSSQEMEAIFVNLEDIIR
VHFALLRAIDMNMLSGGSGLGKIFLDFKERLLIYGQYCSHMENAQKTLDGLIATREDMKI
KVEECTMKVQEGKFKLQDLLVVPMQRVLKYHLLLKELLSHSTDRPERQQLKEALAAMEDL
AMYINEVKRDNETLKKISEFQSSIENLQVKLEEYGRPKIDGELKVSSIVNRTKQDRYIFL
FDKVVIVCKRKGYSYELKEIIELQLYKMSDDPMNNRDMKKWSYGFYLIHLQGKQGFQFFC
KTEENKRKWMEQFEMAMSNIKPERATANQHNFQMHTFDKNTNCRACKMLLRGIFYQGYYC
SRCGTGAHKECLEVITICKQNSPQVNCDSLGLKLFLGPKMVAVRNYHGTPTPPGKTPLCF
QTGDFIELLKGDPDTPWWEGKLIQTQKSGFFPSSCVKPYLDPKSLSSRQSSREADYYGYP
WYFAGNMERQQADNLLKSHCSGTYLIRERTAEAERFAISIKFNDEVKHIKVIEKDNWIHI
TEAKKFESLLELVEYYQSHSLKESFKLLDTTLRHPYKSRERSLTRASTRSPAATCASYNF
SFLSPQGLNFSSQSSAPFWSVFTPRVVSTAVARYNFAARDMRELSLREGDIVKIYSKIGG
DQGWWKGEANGRIGWFPSTYVDEEGVQ
Download sequence
Identical sequences ENSPFOP00000011200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]