SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011275 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011275
Domain Number 1 Region: 367-540
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-38
Family SPRY domain 0.0011
Further Details:      
 
Domain Number 2 Region: 8-78
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-19
Family RING finger domain, C3HC4 0.019
Further Details:      
 
Domain Number 3 Region: 138-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000244
Family B-box zinc-binding domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000011275
Domain Number - Region: 204-279
Classification Level Classification E-value
Superfamily BAG domain 0.0722
Family BAG domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011275   Gene: ENSPFOG00000011300   Transcript: ENSPFOT00000011291
Sequence length 554
Comment pep:novel scaffold:PoeFor_5.1.2:KI519748.1:20332:24110:-1 gene:ENSPFOG00000011300 transcript:ENSPFOT00000011291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LAQHTQLRWFSCQLCLNLLNNPVAIPCGHSYCMSCIQSFWDKKGKKKHHSCPQCRQTFAP
RPALVKNTMLAALVEQLKLTGLQAAAADHAGPEDVACDVCPGRKQKAVRSCLNCLVSYCE
KHLQPHYSAAPLQKHKLVEPSKKLLENICSRHDEVMKVFCLTDQQCICILCTMDEHKGHE
TAPAAAERAKRQKELEENQRQIQKKIEDQEKELKRLQQEVKDACVSADEAVKSTEKIFTE
LITLLQKRRSEVKQQIRSQQKAQVLRVKEVQEKLEQELNDLKRRDTELEKLSHTEDHNQF
LQSYASLSTPSDLADSSGINAVPLRHFEDVTAAASELRDKLQDILRDVETHTLQTVSSSR
PEPKSRAEFLKYACEISLDPNTAFRTLKLSNENRAAIVWYEDESFTPSPERFSSCRQVLS
RQSLTGRCYFEFKWAGIGIFVAVAYKSTKRGGRANESLFGFNDQSWALRCDIEHLSWKGA
GYTFSHNKAETPVSSPQSYKLGVYLDHSAGVLAFYDVSETMTLLHRVQTTFTQPLYAGLG
DGGNAEFCNLKETE
Download sequence
Identical sequences ENSPFOP00000011275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]