SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011500 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011500
Domain Number 1 Region: 875-1055
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.66e-42
Family Ypt/Rab-GAP domain of gyp1p 0.0044
Further Details:      
 
Domain Number 2 Region: 1030-1150
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.89e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0057
Further Details:      
 
Domain Number 3 Region: 152-175,258-368
Classification Level Classification E-value
Superfamily PH domain-like 3.32e-28
Family Phosphotyrosine-binding domain (PTB) 0.0082
Further Details:      
 
Domain Number 4 Region: 3-135
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-16
Family Phosphotyrosine-binding domain (PTB) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011500   Gene: ENSPFOG00000011247   Transcript: ENSPFOT00000011516
Sequence length 1267
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519654.1:2769764:2819375:-1 gene:ENSPFOG00000011247 transcript:ENSPFOT00000011516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEEEIRYQLTMMGFRAVHHLTTMAMLPWVVAEICRSSKKDPGANKTVLLCVSASWVRCV
SVPAERRLWDPLTHTVLFECRPHQVTKLIHNSQEPSVFACLVKDSLKCACYVFQDLDSTK
VPEIISTLRQAGKISATSNSTAPTSAVSPTTFAKKFEVLFCGRVSVAHKKAPPALIDECI
EKFSQLHGSGTTDKGGGGLVDGLRRAFTFPSSGLGNGSVRNGTTGSATTGSSAALFKRDS
SFPNLHLDENGLCPEISNNNTTDSITCSTTVQPTSLQENRTMLFTVGKSQIFLVSPDTKK
VAIEKSFREISFCSQGIRHVDHFGFICRETAEGGSCHFVCYVFQCTDESLVDEIMLTLKQ
AFSVAALQQNAKTQSQQCDSCPIQQLHRLCERIEGLHPSKTKLELQKHLATLDNDEQASV
FENTMRARPKSDQEENELVMASLRNMYEEKQKTHQHSSLDNSKQVSEDATPAPQETQQQS
SSRQRLEQFKSRAKRSLTESLEGIWKGSNKAKPQRESSQGSESSSSSGAVSRGQPCFEDP
LRPTSPLRGHNSAGDLKLLDSSIPLSSSSSSLPDNPEPQGFRRRASTFSHSPSPSSVLED
SPLYMQTHSPQELSAATKPKLVRHYSVSTDNPHQKQEVSRFTLKTVKMFSVNISLPVNRP
KVYDSLLFYSFFICTNFQKSPNSSVFCLPFHHRHLSPLGGLRARLHSSSSVPNFLKFQFL
APVQENDCPEPKSRDVAALSTSRAACVAGESPLRNHRHSWRQQIFLRVATPQKGTDPTGR
NSQYLINGSLFFQYPMDKSNGDSTMRALPEEGTKRSKVELRELWRKAILQQILLQRMESE
NQKLQASESDLQNKRLKLDYEEITPCLKEVTVVWEKLLSTPGRTKVKFDTETIHAAVAQG
VPRQHRGEIWKFLSEQYLLRQTVPSRPPSNHTPYKELLKQLTSQQHAILIDLGRTFPTHP
YFQAQLGAGQLSLFNILKAYSLLDPEVVGYCQGLSFIAGVLLLHMGEEDAFNMLKFLMFD
VGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLHGHLEQQEIGPSLYATPWFLTLFASHFP
LGFVARVFDMLFLQGSEVIFKVALSLLGSHKPLILQHDSLESIVDFIKTTLPNLGLVQME
KTINQVCEMDVSKQLQAYEVEYHVLQDELLDTPPTLNQQQRAAQLERTNQSLRQQNLDLL
EELQVSHARVCNLESRVEALAQSEGQLKEQVSALEEEKKQLASTIAHLHKLLTELGINAD
LDGQTLP
Download sequence
Identical sequences ENSPFOP00000011500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]