SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011716 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011716
Domain Number 1 Region: 38-307
Classification Level Classification E-value
Superfamily L domain-like 9.72e-59
Family Ngr ectodomain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 237-475
Classification Level Classification E-value
Superfamily L domain-like 5.1e-41
Family Ngr ectodomain-like 0.026
Further Details:      
 
Domain Number 3 Region: 538-836
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.04e-28
Family Rhodopsin-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011716   Gene: ENSPFOG00000011103   Transcript: ENSPFOT00000011733
Sequence length 899
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519989.1:369009:409765:1 gene:ENSPFOG00000011103 transcript:ENSPFOT00000011733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKAAAAAGNSSGDSREESSRAAGHATCPGRCRCEGDGLLHRVDCSDLGLREIPSNLSVF
TSYLDLSMNNLTVMTSGALSNLHFLEELRLAGNDLSFIPRGAFSGLYNLKVLMLQNNQLR
SVPAEAFTNLHNLQSLRLDANHISGVPPGCFFGLRSLRHLWLDDNALTEVPVKALGELPT
LQAMTLALNHIAHIPDHAFSKLGRLVVLHLNNNRIVSMGNNCFHGLHSLETLDLNYNSLV
EFPTAIRSLSHLKELGFHSNSIQSIPERAFTGNPSLISLLFYDNPIQSVGRSAFQNLPEL
RTLSLNGAAELAEFPDLSGTKGLESLTITGARITSLPSSMCEQLPNLQLLDLSYNKIQTL
PSFTGCESIQKIDLHHNEIEELRENTFTGLMTLRSLDLSWNRLSSVKPNSFFALTSLSKL
DLSSNQLSSLPLTGLQSLTHIRLVGNDQLMELIPREDLPRVRVMELPYAFQCCAFISCEK
RGEGGLSWEREEAADSTARDAPFLSSQARNFHDFLDQDWDDFLMEFEDEPKPQHSVHCSP
TPGPFRPCLRLLGSWMIRGGVWLIAATSLVSNGLVVLSVFFSPASIVTTPKLLIGLLALV
NGLMGVWSSWLAAVDAWTFGSFWRYGVKWESSFLCRLSGFLCVFASQTGLFLLTVAALER
CLSAAGATQSSKAGRSSGGSSSPLFIRLSIFLCFLLGFVITLPPLMAGHSSSSFCLPLPS
SSSSSSSLAFAVSLVLFDSLCFLVMTLAYTRLYCRASKAPPNSDDDVALTRHVAWLLFSD
CLLYLPVAFLSFSSLLRLPAAGPEAAKGVLLLVTPLPACVNPLLYLLFNPLARGELAALA
ARACRGAAASKLQRRGVTGGRPLDSTYDEDAEKQSCDSTQALVVVEGVKFELLLKAGKA
Download sequence
Identical sequences ENSPFOP00000011716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]