SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011776 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011776
Domain Number 1 Region: 207-473
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-75
Family Nuclear receptor ligand-binding domain 0.00000000551
Further Details:      
 
Domain Number 2 Region: 103-185
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.13e-27
Family Nuclear receptor 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011776   Gene: ENSPFOG00000011712   Transcript: ENSPFOT00000011793
Sequence length 474
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519619.1:2310403:2320556:1 gene:ENSPFOG00000011712 transcript:ENSPFOT00000011793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPYKFGSPIFNMAAELYSPPSPLGESLLDSPLCGDLIENLPDFSQSIGDNSLGFDFPE
YQAIGSGPSSSIPLDTLTPASSPLPGECGASLCPDEDSSPLNLECRVCTDKASGFHYGVH
ACEGCKGFFRRTIRLKLEYDKCERSCKILKKNRNKCQYCRFQKCVSVGMSHNAIRFGRMP
QAEKLKLKEASKVVETEEEDPVKADHKILVRQIHEAYIKNFNMNKAKARLILTGKTSQPP
FIIHDMETFQLAEKTLAAHMIIPALVCEELQQREAEARLFYCCQSTSVETVTELTEFAKA
VPGFQSLDLNDQVTLLKYAVYEALFTLLASCMNKDGLLVARGGGFITREFLKGLRRPFSD
MMEPKFQFATRFNSLGLDDSDLALFVAAIICCGDRPGLVDVPLVEQLQESIIQALRLHLL
ANHPDDAFLFPRLLQKLADLRELVTEHAQLVQDIKTTEDTSLHPLLQEIYRDMY
Download sequence
Identical sequences ENSPFOP00000011776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]