SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011847 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011847
Domain Number 1 Region: 215-228,407-624
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-58
Family Nuclear receptor ligand-binding domain 0.0000944
Further Details:      
 
Domain Number 2 Region: 145-226
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.73e-31
Family Nuclear receptor 0.0000886
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011847   Gene: ENSPFOG00000011747   Transcript: ENSPFOT00000011864
Sequence length 636
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519745.1:194717:204984:-1 gene:ENSPFOG00000011747 transcript:ENSPFOT00000011864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VIMATNLTLLSQQKSDSEHEAEGSCSPSDPVMGESPQRFRVISAEPATTPQQIQIVTDQQ
TGQKIQIVTAMNPSSASKQQFILTTADSSGASKVILASPETHNSKQVIFTAADSLMPGRI
QIVTDPVSMERLLGQSGDLSRSQPVEYCVVCGDKASGRHYGAVSCEGCKGFFKRSVRKNL
TYSCRSKQDCVINKHHRNRCQFCRLRKCLKMGMKTDSVQSERKPIDVVPRERHSNCAAST
QKIYIRKDLNSPLIATPTFISDTDTDGSRSSLLDQGMLVNIQQPVIQADGTLLLATDSKM
DSEHGNLGTLANVVTSLANLSDSLKESLNNGDTSDSQQEEQAASEITRAFDTLAKVFNPP
EAGAEQNLAEKSQCVSGTTIQLIGRDQETPIIEVEGPLLTDSHVGFKLTMPSPMPEYLNV
HYICESASRLLFLSMHWARSIPAFSALGQEANTSLVRACWNELFILGLAQCAHVMNLSTI
LAAIINHLQSSVQDADKLSGERVKQVMEHIWKFQEFCNSMTRLETDSYEYAYLKAIVLFS
PGSDHPGVESSGQVEKFQEKALMELQDYVQKTYPEDTYRLTRILTRLPALRLMNSSITEE
LFFTGLIGNVSIDSIIPYILKMETAEYNSQDSDSTE
Download sequence
Identical sequences ENSPFOP00000011847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]