SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000011889 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000011889
Domain Number 1 Region: 868-1039
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 7.32e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0053
Further Details:      
 
Domain Number 2 Region: 1014-1132
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 155-199,326-412
Classification Level Classification E-value
Superfamily PH domain-like 1.41e-27
Family Phosphotyrosine-binding domain (PTB) 0.0088
Further Details:      
 
Domain Number 4 Region: 11-149
Classification Level Classification E-value
Superfamily PH domain-like 1.28e-20
Family Phosphotyrosine-binding domain (PTB) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000011889   Gene: ENSPFOG00000011463   Transcript: ENSPFOT00000011906
Sequence length 1264
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519629.1:537793:576342:1 gene:ENSPFOG00000011463 transcript:ENSPFOT00000011906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESQEEKESRTDKRFALTYVGWCSLDRRTTLPMLPWLVAEIRRRSERGDCGPVMQPREVQ
LLLNPPFVRCVPTNSSNSSVFIFEHKAQLISRFIHNSNDLTCFSYLLRGQPDNPESEMSC
HVFKACDPNQVPEVISSIRQVSKSALKEDAKPKQEADEAFYNSQKFEVLYCGKVTVGHKK
ASSTLIDDCVEKFRQHETERKRLRLLNGQRGSIETIPVDLLIAGDGDPLSTALSRTTEEP
EAPGLEDLITGKCLPSSASQSSLRGSFPECILEDSDFEEPQEFRTRCSSLAGSLQRKPGE
GVIMGPTRRRHASAPNNVQPSDSDKNRTMLFQVGRFEVNLISPDSKTVVLEKNFKDISSC
CQGVKQTDHFGFICRDQSESGPSQYVCYVFQCANESLVDEVMLTLKQAFSTAAALQSNKT
PVQLCEACPMHDLHKLCERIEGSLYPPRAKLAIQKYLSLLTDNEQAEIFERVQQRLKPGS
DQEENELAIMYLRQLCESKQKSHLHIGETPQNATNSTAAGDGSATGSRFKLDILKNKART
SLTSSLENIFARGASRMRGRLGSMGSMSSFERKTKQMLSQDEESPGHSPPGSPPAFPDDE
LESGPQFRRRAHTFSHPPVRKRISFESQPANQTKQAPLRRQHSVNPELLQARTRSISEGE
SSFSLPSTFSTPTFLKSFYQGSLGSLTDSGSLKSDISLEPSNEEGRKRTLSSCSNDSLSG
GLPLTPRRVSWRQKIFLRVASPMNKPSASMQDTDGSDATELLPLSPRASDPGLDPLRRLL
SPASDQPADKKPKKTGADYRALWKTAIHQQILLLRMEKENQRLEAPNSTEASRDELHIRK
MKLNYQEVCTCSKEAQALWERKLTAPGRTTNPQDKEDIYRAICQGVPKSRRGEVWLLLSH
QHRLQHRLPQRQQAPDTPYYDLLKQLTAQQHAILVDLGRTFPTHQYFSAQLGAGQLSLYN
LLKAYSLMDTEVGYCQGISFVAGVLLLHMREEQAFDMLKFLMYDLGIRRQYRPDMVSLQI
QMYQLSRLLHDYHRDLYNHLEEYEIGPSLYAAPWFLTLFASQFPLGFVSRIFDLVFVQGT
EVIFKVALCLLSNHEREIVECDSFESIVDYLKTTLPTLTQAQMEQTITKVMEMDISKQLH
AYEVEYHVLQDEMLDAGPPPDDSERLDKLEKTNVQLKKQNMDLLEKLQAARQKIQTLETS
VESFLSRESKMKHMIRSLEQERAAYQRTVERMRSSLPPDALTDVEMTQIKTGPNGKAKTA
AKKP
Download sequence
Identical sequences A0A096MET1
ENSPFOP00000011889

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]