SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000012081 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000012081
Domain Number 1 Region: 189-202,388-608
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-56
Family Nuclear receptor ligand-binding domain 0.0000456
Further Details:      
 
Domain Number 2 Region: 119-200
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.3e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000012081   Gene: ENSPFOG00000012037   Transcript: ENSPFOT00000012098
Sequence length 620
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI520015.1:170606:176472:-1 gene:ENSPFOG00000012037 transcript:ENSPFOT00000012098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRMDGQTHKIQLVSTDNSMALGHRIQIVTDQQTGQKIQIVTALEPSSPGKQQFILANADY
SPGGKVILAKQEGSPNKVILASSDGSGVNQLLFAAPELAGQQIQFVTDGSDQSIVKPVVE
YCVVCGDKASGRHYGAVSCEGCKGFFKRSIRKNLVYTCRGSGECAINKLHRNRCQYCRLQ
RCIALGMKQDSVQCERKPVEVATREKSLNCAASTEKIYIRKNLCSPLAATPTFVSEKETA
RSTSLLESSMLLNIQQPFPKLENTILIPASPDKDDLSQGDLGTLANVVTSLAHLNKTREL
SDGGNDAMGAETLSNGDGSMTDVKVEDHSASDITRPRAFDTLAKVLHSDDGSAGESLETT
MQLMSGDQSGPVVELDGPLLSESHIPFKLMMPLPVPEYLNVNYICESASRLLFLSMHWAR
SIPAFQALGGQDNDINLMKACWNELFALGLAQCSNIMNVGTILSAIINHLQTSLQEEKLS
PERGKVVMEHIWRMQEFCNSMSKLSPDSYEYAYLKAIVLFSPGVVFVLDHPGIDNIPQIE
MFQEKAYMELQDYVTRTYPEDSYRLSKLLLRLPALRLISAAVTEELFFAGLIGNVQIDSI
IPYILKMESTDYNSQAGSGV
Download sequence
Identical sequences A0A087Y228
ENSPFOP00000012081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]