SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000012301 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000012301
Domain Number 1 Region: 393-570
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-56
Family SPRY domain 0.0003
Further Details:      
 
Domain Number 2 Region: 139-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 5.95e-16
Family B-box zinc-binding domain 0.00058
Further Details:      
 
Domain Number 3 Region: 6-58
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000495
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000012301
Domain Number - Region: 178-306
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00649
Family FCH domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000012301   Gene: ENSPFOG00000012268   Transcript: ENSPFOT00000012318
Sequence length 571
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519703.1:555916:559994:-1 gene:ENSPFOG00000012268 transcript:ENSPFOT00000012318 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMSSDQDSCYLCKEYLRDPVSIPCGHIFCSICLKTYWDHADHTGSYICPECRVSYNKRPT
PRRMGGSRHSTIQRNSEAFPPPPPSPDYNYAGPQDVGCDICIGKKHKAIKTCLMCLASYC
EKHLKPHFESATFKRHKLVDEIGHLDRQICPQHQKGLELFCRTDQMCICVLCTVKEHKGH
DMVSAEQERAEEQQRLGATQAEIQEKIHDRLKQMEELKQAVDSLKNSAQRALQECEKMFS
DMMRSIERMQQEMAKLISSNKRAALNNAEGHMERLNHEIADLKNRDTQITQLSRTEDHIH
FIQSYHMLIAQTEAEELPSVSVNPYFTFGSVTKAVSEMKQHLNEFSNDELVKVATTVNKM
TFCQLDEPKKKRAIKSEEAVMYKAVPVQEPQYRDDFLRYACELTLDPNTAYRQLYLSRGN
KKAALKRDPQDYGDNPSRFDSLPQVLCKENLAGGAYYWEVDWSGEGVALGVTYKGIKRAG
YGDSCRIGYNRKSWSLFCSDSSYSARHNKDQTEINAPYSSRIGVFLDYDGGTLSFYTVRE
TMSLLHRFKTSFSEPVYPGFWVWYDSAVTLV
Download sequence
Identical sequences ENSPFOP00000012301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]