SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000012363 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000012363
Domain Number 1 Region: 398-569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-51
Family SPRY domain 0.00054
Further Details:      
 
Domain Number 2 Region: 8-80
Classification Level Classification E-value
Superfamily RING/U-box 9.28e-19
Family RING finger domain, C3HC4 0.024
Further Details:      
 
Domain Number 3 Region: 145-207
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.1e-16
Family B-box zinc-binding domain 0.00067
Further Details:      
 
Weak hits

Sequence:  ENSPFOP00000012363
Domain Number - Region: 217-300
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0445
Family HBL-like 0.067
Further Details:      
 
Domain Number - Region: 269-350
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000012363   Gene: ENSPFOG00000012322   Transcript: ENSPFOT00000012380
Sequence length 577
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519703.1:565442:571555:1 gene:ENSPFOG00000012322 transcript:ENSPFOT00000012380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTMADHTSPDYFSCSLCQSLLRDPVAIPCGHSFCMDCIDGYWNEADYTGIYICPQCKITF
TQRPVLRPNATLTMVAEKIKKSGLNVNLSASQANVYAGTNDVPCDFCTGKKLKAVKSCLN
CLASYCEKHLRPHYESAMFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTV
SEHRGHDIVSAEAERGEKQKLLGVSQAEIKQKCQERVKELEELKTAVDSLKNSAQRAMVE
SQKMFEDMIRSIERMRSEVTKLIGINEKAAFNQAEALIERLEQEIDELKKKETGLKQLYS
TEDHIHFLQNFNYLCTPTDDGFIPKVTVNPDFSFAAVRKAVAEIKDRLEEFGREELLKIS
KTVNEVPVYTTESRTLDRRSRGKEMTVDNTPPPEPKTRADFIKYFCQLKLDPITAYKELY
ISEGSRKVIRTRDLQPYSDSPERFDSFAQVLCREALSGGRFYWEIEWSGEFSIGVAYRSI
SRKGKGSLCLLGYNDKSWSLLCSDTGYSAWHNRVDKAVNGPHSPRIGVYLDHTAGVLAFY
SIGSSSMTLLHRFQTTFVEPVYPGFGVGTSVKICNVK
Download sequence
Identical sequences ENSPFOP00000012363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]