SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000012609 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000012609
Domain Number 1 Region: 380-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-46
Family SPRY domain 0.00094
Further Details:      
 
Domain Number 2 Region: 12-81
Classification Level Classification E-value
Superfamily RING/U-box 1.39e-17
Family RING finger domain, C3HC4 0.014
Further Details:      
 
Domain Number 3 Region: 143-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000275
Family B-box zinc-binding domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000012609   Gene: ENSPFOG00000012484   Transcript: ENSPFOT00000012626
Sequence length 558
Comment pep:novel scaffold:PoeFor_5.1.2:KI519736.1:235827:238641:1 gene:ENSPFOG00000012484 transcript:ENSPFOT00000012626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKKMAAKSEASYSLCCSVCLEAMKKPVTLPCGHSYCMDCVSNYWDLEDAKGVCSCPQCRH
TFNSRPVLNKNTVLVDLIEKMAEPERTTRLCEKQAKPNEVECDFCTVKKLKAVKTCLVCL
ASYCGTHVQPHYESAAFQRHKLVEVSGSIQEKICSKHDKLLEVYCRSDDECICLLCVMDE
HKGHDTVSAAAARREKQKLCGEKKQRNQQRIGEKVKQVRQLGQKMKALKLSRDAALDQNE
KIYAEIVSVADKRRSVVRELIKHQENAASGQTETLISQLEKEIRDLRGREDEMRKLSSTE
DNIYFLQHCKPIFNGTEPKVSLNFDLQQCLSFDCVTKAISDLKNKMETLSTAIKEISDTS
KNTTEYNTFTFETVPDPTTRQELCMYSCSLSLDPNTAFENLLLSEENTKVIWTKKAQAYP
YHTERFTKYDQVLCAEGLSGVCYWEVEWKGPRVEVAVCYKEPNMKESCFGYNDQSWSVSL
ANSGCTFWHNEMKIKIPNPCSPRMGLYLNHKAGTLSFYSVSCSEQLVLLHKVQTTFSQPL
YPGFMVSKGASVKIIKQQ
Download sequence
Identical sequences ENSPFOP00000012609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]