SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000012611 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000012611
Domain Number 1 Region: 374-553
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-40
Family SPRY domain 0.0016
Further Details:      
 
Domain Number 2 Region: 6-78
Classification Level Classification E-value
Superfamily RING/U-box 1.32e-19
Family RING finger domain, C3HC4 0.0056
Further Details:      
 
Domain Number 3 Region: 141-202
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000198
Family B-box zinc-binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000012611   Gene: ENSPFOG00000012628   Transcript: ENSPFOT00000012628
Sequence length 555
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519736.1:239237:243896:1 gene:ENSPFOG00000012628 transcript:ENSPFOT00000012628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSLDLLDCSICLQLLDEPVTTACGHSFCKTCINTFWDTGRNLKGKYSCPQCRTTFSPK
PALQRNTVLANLLEEHKTKPSQSAAGDESDVALPGDVPCDSCTARKRKAEMYCLMCLASF
CETHVQPHFQLPVLKKHKLIQASTRIKESICSRHDRLFEIYCRTDEQLVCPLCVVQHKNH
DIVEVTAEVKAKQEELERTRKKIADAVRVSQCEIGQLEEAAKSIRDAAWESSDNFEQRCT
EHLRLYAHFLEKKCLEMRGKVEEVEKAGVDWTNGHKARLKREVHKLKEMDHKLCQLAQTD
DPIQFLKDIQAVGGLPVFSGSHEGLVSLKEFVSAKTNQLKSMCGKQNVQLFGHFMDNIMM
HIPRKLHIKPTTRKDILAKFIYPTLDPHTVHACLYMANTKRELSWGITGQAHPDHPDRFS
HFYQSLCQDDLQENNYWEVEWDGGIIEVAVSYKGIQRKGQGKDSCFGHNKLSWKIICSPS
GCTFWHNSLHKGLIPPAQSRRVGVHLEYNEGKLSFYSVSRIGELTLLHRVQTTFSEPLYP
GFSVDLGASLTMCKF
Download sequence
Identical sequences A0A087Y3K8
ENSPFOP00000012611 XP_007561442.1.10163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]