SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000013107 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000013107
Domain Number 1 Region: 525-696
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-44
Family SPRY domain 0.00033
Further Details:      
 
Domain Number 2 Region: 291-357
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000366
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 5-65
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000631
Family RING finger domain, C3HC4 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000013107   Gene: ENSPFOG00000013098   Transcript: ENSPFOT00000013125
Sequence length 701
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519856.1:484617:491966:-1 gene:ENSPFOG00000013098 transcript:ENSPFOT00000013125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAALDTPARCLLCDVMTQNPVTLKCNHRFCRRCIGDLWSVSPSGPFHCPESRCKVVYQT
LPFVAYTESTATSTEHRSLNLNLEEKPLKLHGVNLNNHRNFFFANPCFVFGAATSSSQSE
QSTSASDSRRPTLTSRLLGKRKATTPISEEHVAKRTAVESTNDRSRTAETPTVSFSDQPE
DPENSDRRPAESDWSQKSADDSDSSSESLSPGNKSAPVSKTPLMSTSASSNRLGLFLRPE
RSNSSPVPCHYCPKTGHQQAVKTCLVCGASMCTEHLRPHLESPVFQNHTLVSPMEDISLW
RCQEHQEINRIYCRQCAACVCTVCTVIGSHRDHACISIREAEKELRANLKEEIKQLQEAE
QQVKNRVTELTEKKETFTAVLTEALDGVKQQYGAIREALDQEEQTALRCVKEEESRVLGG
LEKKLCLLQGSLQSIQNGLHVLEGLADARADTRVQDQAFIMEYSRISQLTSEVGNCAGQF
APPEEVDRGRLSCLQRWTEKRLDAVVITMPGKDRDLYRLLYGTVPALDADTAHPKLQLSE
ANRKVAYSESPQAYADHQARFSSFPQVLASSPLQGGRWYWEVSVSVDDGRWKVGLSTAQI
ERKGQKDGSRLGCNSYSWCLACDKRKLEALHNKETAAVRADGLQRVGVFLDFEEGSLSFF
DATPGGSLALLHSYKHSFCEPLYPALSVSKTHLTVCDLFHS
Download sequence
Identical sequences ENSPFOP00000013107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]