SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000013126 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000013126
Domain Number 1 Region: 399-566
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.68e-51
Family SPRY domain 0.0004
Further Details:      
 
Domain Number 2 Region: 139-203
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000105
Family B-box zinc-binding domain 0.00071
Further Details:      
 
Domain Number 3 Region: 8-69
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000571
Family RING finger domain, C3HC4 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000013126   Gene: ENSPFOG00000013089   Transcript: ENSPFOT00000013144
Sequence length 577
Comment pep:novel scaffold:PoeFor_5.1.2:KI519815.1:634222:639071:-1 gene:ENSPFOG00000013089 transcript:ENSPFOT00000013144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSGFPLPPDSFCPLCTDGLRDPVTIPCGDTYCLECIKIYWDQFDHMGVYSCPQCRASF
TPRPVLRRNVPDVQHQQQPRQQLPELTPFPYMHRESYCDFCVGRRNRAVKSCLMCLAYYC
ETHVKPHYESSTFKRHKLVDETGHLDRKICPQHEKGLELFCRSDQMCICVLCTVREHRSH
NIASAEEERIEKQKVLVVTQSEVQHIISERMKELQDLKHNVDVLKNAAQRAQTESDKTFH
EMLQAVERWKSEINQMIMANMQAAMTQADGYVERLEQEIMELQRRDAELRQILETEDNIH
FLQNFPTLCVPPEAMVPKVLINPQFSFGEISKTAIEMKESLDDICKKELNKISKTVSETP
VYILLPRNGDKRLKVIHIVPSRVDFQEPKSRTDFLRYAVRLSFDSNTVYKELVLSDGNQR
VTRRKTTQYYPDHPERFDGFSQVLCKEPLSGFRFYWEAEWGGEFSIGVAYKSISRKGKNS
NSLLGYNDKSWSLLCSDSGYSAWHNKADKDLPDAPRATRIGVYLDYAGNTLAFYSISNTM
ELIHRFRAQFSEPLFAGFGVGSSVTLCQLKQNTMPYT
Download sequence
Identical sequences ENSPFOP00000013126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]