SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPFOP00000013180 from Poecilia formosa 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPFOP00000013180
Domain Number 1 Region: 233-290,323-528
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 6.16e-74
Family Nuclear receptor ligand-binding domain 0.0000000117
Further Details:      
 
Domain Number 2 Region: 129-213
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.73e-27
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPFOP00000013180   Gene: ENSPFOG00000013138   Transcript: ENSPFOT00000013198
Sequence length 530
Comment pep:known_by_projection scaffold:PoeFor_5.1.2:KI519612.1:2679328:2724252:1 gene:ENSPFOG00000013138 transcript:ENSPFOT00000013198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDTQQLLAWPVGFSLSTVDLPELDDSPHYLDMKHLSTSDYASVSSSSIPSSLSPPLVSA
ISSAGLAYDISPPLSEEHLTNMDYTNMHSYRTEMETHNPIKMEPESPPQYSDNPLFSKFP
DDASASALNIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLVYDHCDLHCRIHKKSR
NKCQYCRFQKCLNVGMSHNAIRFGRMPQAEKEKLLAEFSSDMEHMHPEAADLRALARHLY
EAYLKYFPLTKAKARAILSGKTGEKVPFIIHDMKSLIEGEQFINCRQIPSREQQQMSTVT
AGVSGIPGAHSGSDYGALGTGINGLTPDGAELRFFKSCQSRSAEAVREVTEFAKSIPGFI
DLDLNDQVTLLKYGVIEVLIIMMSPLMNKDGTLISYGQIFMTREFLKSLRKPFCQMMEPK
FEFGVKFNTLELDDSDMALFLAVIILSGDRPGLLNVKPIEQLQETVLHSLELQLKLSHPD
SLQLFAKLLQKMTDLRQIVTDHVHLIELLKQTEVDMLLHPLLQEIMKDLY
Download sequence
Identical sequences A0A087Y577
ENSPFOP00000013180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]